Solution structure of MsPTH
MAEPLLVVGL GNPGPTYAKT RHNLGFMVAD VLAGRIGSAF KVHKKSGAEV VTGRLAGTSV VLAKPRCYMN ESGRQVGPLA KFYSVPPQQI VVIHDELDID FGRIRLKLGG GEGGHNGLRS VASALGTKNF HRVRIGVGRP PGRKDPAAFV LENFTAAERA EVPTIVEQAA DATELLIAQG LEPAQNTVHA W
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.3 % (1884 of 2134) | 87.6 % (966 of 1103) | 89.3 % (748 of 838) | 88.1 % (170 of 193) |
Backbone | 96.0 % (1077 of 1122) | 95.2 % (374 of 393) | 97.1 % (534 of 550) | 94.4 % (169 of 179) |
Sidechain | 82.2 % (970 of 1180) | 83.4 % (592 of 710) | 82.7 % (377 of 456) | 7.1 % (1 of 14) |
Aromatic | 31.5 % (41 of 130) | 32.3 % (21 of 65) | 31.3 % (20 of 64) | 0.0 % (0 of 1) |
Methyl | 97.5 % (236 of 242) | 99.2 % (120 of 121) | 95.9 % (116 of 121) |
1. MsPTH
MAEPLLVVGL GNPGPTYAKT RHNLGFMVAD VLAGRIGSAF KVHKKSGAEV VTGRLAGTSV VLAKPRCYMN ESGRQVGPLA KFYSVPPQQI VVIHDELDID FGRIRLKLGG GEGGHNGLRS VASALGTKNF HRVRIGVGRP PGRKDPAAFV LENFTAAERA EVPTIVEQAA DATELLIAQG LEPAQNTVHA WSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MsPTH | [U-98% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | AEBSF protease inhibitor | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 1 % | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | MsPTH | [U-98% 13C; U-98% 15N] | 0.9 mM | |
18 | sodium phosphate | natural abundance | 20 mM | |
19 | sodium chloride | natural abundance | 50 mM | |
20 | DTT | natural abundance | 1 mM | |
21 | AEBSF protease inhibitor | natural abundance | 1 mM | |
22 | sodium azide | natural abundance | 1 % | |
23 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MsPTH | [U-98% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | AEBSF protease inhibitor | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 1 % | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MsPTH | [U-98% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | AEBSF protease inhibitor | natural abundance | 1 mM | |
6 | sodium azide | natural abundance | 1 % | |
7 | H2O | natural abundance | 93 % | |
8 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | MsPTH | [U-98% 13C; U-98% 15N] | 0.9 mM | |
18 | sodium phosphate | natural abundance | 20 mM | |
19 | sodium chloride | natural abundance | 50 mM | |
20 | DTT | natural abundance | 1 mM | |
21 | AEBSF protease inhibitor | natural abundance | 1 mM | |
22 | sodium azide | natural abundance | 1 % | |
23 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | MsPTH | [U-98% 13C; U-98% 15N] | 0.9 mM | |
18 | sodium phosphate | natural abundance | 20 mM | |
19 | sodium chloride | natural abundance | 50 mM | |
20 | DTT | natural abundance | 1 mM | |
21 | AEBSF protease inhibitor | natural abundance | 1 mM | |
22 | sodium azide | natural abundance | 1 % | |
23 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | MsPTH | [U-98% 13C; U-98% 15N] | 0.9 mM | |
18 | sodium phosphate | natural abundance | 20 mM | |
19 | sodium chloride | natural abundance | 50 mM | |
20 | DTT | natural abundance | 1 mM | |
21 | AEBSF protease inhibitor | natural abundance | 1 mM | |
22 | sodium azide | natural abundance | 1 % | |
23 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | MsPTH | [U-98% 13C; U-98% 15N] | 0.9 mM | |
18 | sodium phosphate | natural abundance | 20 mM | |
19 | sodium chloride | natural abundance | 50 mM | |
20 | DTT | natural abundance | 1 mM | |
21 | AEBSF protease inhibitor | natural abundance | 1 mM | |
22 | sodium azide | natural abundance | 1 % | |
23 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MsPTH | [U-98% 13C; U-98% 15N] | 1 mM | |
10 | sodium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 50 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | AEBSF protease inhibitor | natural abundance | 1 mM | |
14 | sodium azide | natural abundance | 1 % | |
15 | H2O | natural abundance | 93 % | |
16 | D2O | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17811_2lgj.nef |
Input source #2: Coordindates | 2lgj.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAEPLLVVGLGNPGPTYAKTRHNLGFMVADVLAGRIGSAFKVHKKSGAEVVTGRLAGTSVVLAKPRCYMNESGRQVGPLAKFYSVPPQQIVVIHDELDID |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAEPLLVVGLGNPGPTYAKTRHNLGFMVADVLAGRIGSAFKVHKKSGAEVVTGRLAGTSVVLAKPRCYMNESGRQVGPLAKFYSVPPQQIVVIHDELDID -------110-------120-------130-------140-------150-------160-------170-------180-------190- FGRIRLKLGGGEGGHNGLRSVASALGTKNFHRVRIGVGRPPGRKDPAAFVLENFTAAERAEVPTIVEQAADATELLIAQGLEPAQNTVHAW ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| FGRIRLKLGGGEGGHNGLRSVASALGTKNFHRVRIGVGRPPGRKDPAAFVLENFTAAERAEVPTIVEQAADATELLIAQGLEPAQNTVHAW
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 191 | 0 | 0 | 100.0 |
Content subtype: combined_17811_2lgj.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAEPLLVVGLGNPGPTYAKTRHNLGFMVADVLAGRIGSAFKVHKKSGAEVVTGRLAGTSVVLAKPRCYMNESGRQVGPLAKFYSVPPQQIVVIHDELDID |||||||||||||| |||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||| |||||||||||| MAEPLLVVGLGNPG.TYAKTRHNLGFMVADVLAGRIGSAFKVH.KSGAEVVTGRLAGTSVVLAKPRCYMNESGRQVGPLAKFYSV...QIVVIHDELDID -------110-------120-------130-------140-------150-------160-------170-------180-------190- FGRIRLKLGGGEGGHNGLRSVASALGTKNFHRVRIGVGRPPGRKDPAAFVLENFTAAERAEVPTIVEQAADATELLIAQGLEPAQNTVHAW ||||||||||||||||||||||||||||| ||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||| FGRIRLKLGGGEGGHNGLRSVASALGTKN.HRVRIGVGR.PGRKDPAAFVLENFTAAERAEVPTIVEQAADATELLIAQGLEPAQNTVHAW
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1103 | 949 | 86.0 |
13C chemical shifts | 838 | 735 | 87.7 |
15N chemical shifts | 206 | 165 | 80.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 393 | 371 | 94.4 |
13C chemical shifts | 382 | 368 | 96.3 |
15N chemical shifts | 179 | 165 | 92.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 710 | 578 | 81.4 |
13C chemical shifts | 456 | 367 | 80.5 |
15N chemical shifts | 27 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 124 | 122 | 98.4 |
13C chemical shifts | 124 | 113 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 20 | 30.8 |
13C chemical shifts | 64 | 20 | 31.2 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAEPLLVVGLGNPGPTYAKTRHNLGFMVADVLAGRIGSAFKVHKKSGAEVVTGRLAGTSVVLAKPRCYMNESGRQVGPLAKFYSVPPQQIVVIHDELDID ||| ||||||||| ||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAE.LLVVGLGNP...YAKTRHNLGFMVADVLAGRIGSAFKVH.KSGAEVVTGRLAGTSVVLAKPRCYMNESGRQVGPLAKFYSVPPQQIVVIHDELDID -------110-------120-------130-------140-------150-------160-------170-------180-------190- FGRIRLKLGGGEGGHNGLRSVASALGTKNFHRVRIGVGRPPGRKDPAAFVLENFTAAERAEVPTIVEQAADATELLIAQGLEPAQNTVHAW |||||||||| | ||||||||||||||| ||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||| FGRIRLKLGG..G.HNGLRSVASALGTKN.HRVRIGVGR.PGRKDPAAFVLENFTAAERAEVPTIVEQAADATELLIAQGLEPAQNTVHAW
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAEPLLVVGLGNPGPTYAKTRHNLGFMVADVLAGRIGSAFKVHKKSGAEVVTGRLAGTSVVLAKPRCYMNESGRQVGPLAKFYSVPPQQIVVIHDELDID |||||||||||| |||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| |||||||||||| .AEPLLVVGLGNP..TYAKTRHNLGFMVADVLAGRIGSAFKVH.KSGAEVVTGRLAGTSVVLAKPRCYMNESGRQVGPLAKFYSVP..QIVVIHDELDID --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180-------190- FGRIRLKLGGGEGGHNGLRSVASALGTKNFHRVRIGVGRPPGRKDPAAFVLENFTAAERAEVPTIVEQAADATELLIAQGLEPAQNTVHAW |||||||||||| |||||||||||||||||||||||||| ||||||||||| |||||||||||||||||||||||||||||||||||| FGRIRLKLGGGE..HNGLRSVASALGTKNFHRVRIGVGRP..RKDPAAFVLEN.TAAERAEVPTIVEQAADATELLIAQGLEPAQNTVHA -------110-------120-------130-------140-------150-------160-------170-------180-------190