Solution structure of C2B with IP6
QEKLGDICFS LRYVPTAGKL TVVILEAKNL KKMDVGGLSD PYVKIHLMQN GKRLKKKKTT IKKNTLNPYY NESFSFEVPF EQIQKVQVVV TVLDYDKIGK NDAIGKVFVG YNSTGAELRH WSDMLANPRR PIAQWHTLQV EEEVDAMLAV KK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.6 % (1681 of 1855) | 94.4 % (917 of 971) | 86.0 % (620 of 721) | 88.3 % (144 of 163) |
Backbone | 97.6 % (878 of 900) | 98.4 % (302 of 307) | 96.6 % (432 of 447) | 98.6 % (144 of 146) |
Sidechain | 86.2 % (946 of 1098) | 92.6 % (615 of 664) | 79.4 % (331 of 417) | 0.0 % (0 of 17) |
Aromatic | 34.3 % (46 of 134) | 61.2 % (41 of 67) | 7.7 % (5 of 65) | 0.0 % (0 of 2) |
Methyl | 91.8 % (169 of 184) | 97.8 % (90 of 92) | 85.9 % (79 of 92) |
1. entity 1
QEKLGDICFS LRYVPTAGKL TVVILEAKNL KKMDVGGLSD PYVKIHLMQN GKRLKKKKTT IKKNTLNPYY NESFSFEVPF EQIQKVQVVV TVLDYDKIGK NDAIGKVFVG YNSTGAELRH WSDMLANPRR PIAQWHTLQV EEEVDAMLAV KKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | indirect | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | indirect | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | indirect | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbon | 0.0 ppm | internal | indirect | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 1.0 |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian varian - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details C2B (13C & 15N labeled) with unlabeled IP6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C2B domain | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | IHP | natural abundance | 1.1 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | Calcium Chloride | natural abundance | 2 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17838_2lha.nef |
Input source #2: Coordindates | 2lha.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | IHP | INOSITOL HEXAKISPHOSPHATE | None |
Sequence alignments
270-----280-------290-------300-------310-------320-------330-------340-------350-------360-------37 QEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------380-------390-------400-------410-------420- NDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK |||||||||||||||||||||||||||||||||||||||||||||||||||| NDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK -------110-------120-------130-------140-------150--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 152 | 0 | 0 | 100.0 |
Content subtype: combined_17838_2lha.nef
Assigned chemical shifts
270-----280-------290-------300-------310-------320-------330-------340-------350-------360-------37 QEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGK 0-------380-------390-------400-------410-------420- NDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK |||||||||||||||||||||||||||||||||||||||||||||||||||| NDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
334 | THR | HG1 | 0.72 |
389 | HIS | HD1 | 7.19 |
405 | HIS | HD1 | 6.25 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 971 | 912 | 93.9 |
13C chemical shifts | 721 | 597 | 82.8 |
15N chemical shifts | 168 | 142 | 84.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 307 | 303 | 98.7 |
13C chemical shifts | 304 | 286 | 94.1 |
15N chemical shifts | 146 | 142 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 664 | 609 | 91.7 |
13C chemical shifts | 417 | 311 | 74.6 |
15N chemical shifts | 22 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 93 | 96.9 |
13C chemical shifts | 96 | 81 | 84.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 40 | 59.7 |
13C chemical shifts | 65 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
270-----280-------290-------300-------310-------320-------330-------340-------350-------360-------37 QEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGK 0-------380-------390-------400-------410-------420- NDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK |||||||||||||||||||||||||||||| ||||||||||||||||||||| NDAIGKVFVGYNSTGAELRHWSDMLANPRR.IAQWHTLQVEEEVDAMLAVKK