GB98-T25I,L20A
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.7 % (603 of 680) | 86.0 % (301 of 350) | 89.6 % (242 of 270) | 100.0 % (60 of 60) |
Backbone | 98.2 % (330 of 336) | 98.2 % (112 of 114) | 97.6 % (162 of 166) | 100.0 % (56 of 56) |
Sidechain | 82.2 % (327 of 398) | 80.1 % (189 of 236) | 84.8 % (134 of 158) | 100.0 % (4 of 4) |
Aromatic | 66.1 % (37 of 56) | 82.1 % (23 of 28) | 48.1 % (13 of 27) | 100.0 % (1 of 1) |
Methyl | 82.5 % (66 of 80) | 82.5 % (33 of 40) | 82.5 % (33 of 40) |
1. entity
TTYKLILNLK QAKEEAIKEA VDAGIAEKYF KLIANAKTVE GVWTYKDEIK TFTVTESolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DMX - 600 MHz with a Z axis gradient 1H/13C/15N triple resonance cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DMX - 600 MHz with a Z axis gradient 1H/13C/15N triple resonance cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DMX - 600 MHz with a Z axis gradient 1H/13C/15N triple resonance cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DMX - 600 MHz with a Z axis gradient 1H/13C/15N triple resonance cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DMX - 600 MHz with a Z axis gradient 1H/13C/15N triple resonance cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DMX - 600 MHz with a Z axis gradient 1H/13C/15N triple resonance cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DMX - 600 MHz with a Z axis gradient 1H/13C/15N triple resonance cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DMX - 600 MHz with a Z axis gradient 1H/13C/15N triple resonance cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DMX - 600 MHz with a Z axis gradient 1H/13C/15N triple resonance cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DMX - 600 MHz with a Z axis gradient 1H/13C/15N triple resonance cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 278 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GB98-T25I,L20A | [U-100% 13C; U-100% 15N] | 0.1 ~ 0.3 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17841_2lhe.nef |
Input source #2: Coordindates | 2lhe.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKEAVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE |||||||||||||||||||||||||||||||||||||||||||||||||||||||| TTYKLILNLKQAKEEAIKEAVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 56 | 0 | 0 | 100.0 |
Content subtype: combined_17841_2lhe.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKEAVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE |||||||||||||||||||||||||||||||||||||||||||||||||||||||| TTYKLILNLKQAKEEAIKEAVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 350 | 299 | 85.4 |
13C chemical shifts | 270 | 238 | 88.1 |
15N chemical shifts | 60 | 59 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 114 | 113 | 99.1 |
13C chemical shifts | 112 | 107 | 95.5 |
15N chemical shifts | 56 | 55 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 236 | 186 | 78.8 |
13C chemical shifts | 158 | 131 | 82.9 |
15N chemical shifts | 4 | 4 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 30 | 75.0 |
13C chemical shifts | 40 | 30 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 23 | 82.1 |
13C chemical shifts | 27 | 13 | 48.1 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKEAVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE |||||||||||||||||||||||||||||||||||||||||||||||||||||||| TTYKLILNLKQAKEEAIKEAVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKEAVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE | |||||| | | | | |||||||||||||||| | | | ||||||| T.YKLILN.....E.A.K.A..AGIAEKYFKLIANAKT...V.T.K...KTFTVTE
Dihedral angle restraints
--------10--------20--------30--------40--------50------ TTYKLILNLKQAKEEAIKEAVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE |||||| ||||||||| |||||||||||||| ||||||| ||||||| ..YKLILN...AKEEAIKEA....IAEKYFKLIANAKT..GVWTYKD..KTFTVTE