1H, 13C, 15N assignment and secondary structure determination of GATase subunit of GMP Synthetase from Methanococcus jannaschii
MIVILDNGGQ YVHRIHRSLK YIGVSSKIVP NTTPLEEIES NKEVKGIILS GGPDIEKAKN CIDIALNAKL PILGICLGHQ LIALAYGGEV GRAEAEEYAL TKVYVDKEND LFKNVPREFN AWASHKDEVK KVPEGFEILA HSDICQVEAM KHKTKPIYGV QFHPEVAHTE YGNEILKNFC KVCGYKFE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 62.0 % (1378 of 2223) | 63.8 % (738 of 1157) | 52.2 % (455 of 871) | 94.9 % (185 of 195) |
Backbone | 82.4 % (916 of 1112) | 91.9 % (352 of 383) | 70.7 % (388 of 549) | 97.8 % (176 of 180) |
Sidechain | 49.2 % (632 of 1284) | 50.0 % (387 of 774) | 47.7 % (236 of 495) | 60.0 % (9 of 15) |
Aromatic | 23.2 % (39 of 168) | 42.9 % (36 of 84) | 2.4 % (2 of 83) | 100.0 % (1 of 1) |
Methyl | 59.8 % (134 of 224) | 70.5 % (79 of 112) | 49.1 % (55 of 112) |
1. GATase subunit
MIVILDNGGQ YVHRIHRSLK YIGVSSKIVP NTTPLEEIES NKEVKGIILS GGPDIEKAKN CIDIALNAKL PILGICLGHQ LIALAYGGEV GRAEAEEYAL TKVYVDKEND LFKNVPREFN AWASHKDEVK KVPEGFEILA HSDICQVEAM KHKTKPIYGV QFHPEVAHTE YGNEILKNFC KVCGYKFESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | GATase subunit | [U-99% 13C; U-99% 15N] | 0.6 mM | |
10 | H2O | natural abundance | 90 % | |
11 | D2O | natural abundance | 10 % | |
12 | potassium phosphate | natural abundance | 20 mM | |
13 | EDTA | natural abundance | 0.1 mM | |
14 | DTT | natural abundance | 2 mM | |
15 | PMSF | natural abundance | 1 mM | |
16 | sodium azide | natural abundance | 0.01 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GATase subunit | [U-99% 15N] | 0.7 mM | |
2 | D2O | natural abundance | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | PMSF | natural abundance | 1 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | EDTA | natural abundance | 0.1 mM | |
7 | DTT | natural abundance | 2 mM | |
8 | sodium azide | natural abundance | 0.01 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17935_2lxn.nef |
Input source #2: Coordindates | 2lxn.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MIVILDNGGQYVHRIHRSLKYIGVSSKIVPNTTPLEEIESNKEVKGIILSGGPDIEKAKNCIDIALNAKLPILGICLGHQLIALAYGGEVGRAEAEEYAL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MIVILDNGGQYVHRIHRSLKYIGVSSKIVPNTTPLEEIESNKEVKGIILSGGPDIEKAKNCIDIALNAKLPILGICLGHQLIALAYGGEVGRAEAEEYAL -------110-------120-------130-------140-------150-------160-------170-------180-------- TKVYVDKENDLFKNVPREFNAWASHKDEVKKVPEGFEILAHSDICQVEAMKHKTKPIYGVQFHPEVAHTEYGNEILKNFCKVCGYKFE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TKVYVDKENDLFKNVPREFNAWASHKDEVKKVPEGFEILAHSDICQVEAMKHKTKPIYGVQFHPEVAHTEYGNEILKNFCKVCGYKFE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 188 | 0 | 0 | 100.0 |
Content subtype: combined_17935_2lxn.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MIVILDNGGQYVHRIHRSLKYIGVSSKIVPNTTPLEEIESNKEVKGIILSGGPDIEKAKNCIDIALNAKLPILGICLGHQLIALAYGGEVGRAEAEEYAL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MIVILDNGGQYVHRIHRSLKYIGVSSKIVPNTTPLEEIESNKEVKGIILSGGPDIEKAKNCIDIALNAKLPILGICLGHQLIALAYGGEVGRAEAEEYAL -------110-------120-------130-------140-------150-------160-------170-------180-------- TKVYVDKENDLFKNVPREFNAWASHKDEVKKVPEGFEILAHSDICQVEAMKHKTKPIYGVQFHPEVAHTEYGNEILKNFCKVCGYKFE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| TKVYVDKENDLFKNVPREFNAWASHKDEVKKVPEGFEILAHSDICQVEAMKHKTKPIYGVQFHPEVAHT.YGNEILKNFCKVCGYKFE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
20 | LYS | HZ1 | 7.129 |
20 | LYS | HZ2 | 7.129 |
20 | LYS | HZ3 | 7.129 |
30 | PRO | N | 111.914 |
32 | THR | HG1 | 1.22 |
69 | LYS | HZ1 | 6.975 |
69 | LYS | HZ2 | 6.975 |
69 | LYS | HZ3 | 6.975 |
101 | THR | HG1 | 0.989 |
102 | LYS | HZ1 | 6.215 |
102 | LYS | HZ2 | 6.215 |
102 | LYS | HZ3 | 6.215 |
113 | LYS | HZ1 | 8.425 |
113 | LYS | HZ2 | 8.425 |
113 | LYS | HZ3 | 8.425 |
130 | LYS | HZ1 | 10.506 |
130 | LYS | HZ2 | 10.506 |
130 | LYS | HZ3 | 10.506 |
130 | LYS | NZ | 128.701 |
141 | HIS | HD1 | 6.687 |
152 | HIS | HD1 | 6.748 |
152 | HIS | HE2 | 9.482 |
153 | LYS | HZ1 | 8.096 |
153 | LYS | HZ2 | 8.096 |
153 | LYS | HZ3 | 8.096 |
155 | LYS | HZ1 | 7.722 |
155 | LYS | HZ2 | 7.722 |
155 | LYS | HZ3 | 7.722 |
180 | CYS | HG | 2.034 |
181 | LYS | HZ1 | 7.117 |
181 | LYS | HZ2 | 7.117 |
181 | LYS | HZ3 | 7.117 |
183 | CYS | HG | 1.459 |
186 | LYS | HZ1 | 7.138 |
186 | LYS | HZ2 | 7.138 |
186 | LYS | HZ3 | 7.138 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 871 | 395 | 45.4 |
1H chemical shifts | 1157 | 675 | 58.3 |
15N chemical shifts | 199 | 183 | 92.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 376 | 186 | 49.5 |
1H chemical shifts | 383 | 338 | 88.3 |
15N chemical shifts | 180 | 174 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 495 | 209 | 42.2 |
1H chemical shifts | 774 | 337 | 43.5 |
15N chemical shifts | 19 | 9 | 47.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 114 | 46 | 40.4 |
1H chemical shifts | 114 | 74 | 64.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 83 | 0 | 0.0 |
1H chemical shifts | 84 | 33 | 39.3 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MIVILDNGGQYVHRIHRSLKYIGVSSKIVPNTTPLEEIESNKEVKGIILSGGPDIEKAKNCIDIALNAKLPILGICLGHQLIALAYGGEVGRAEAEEYAL |||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .IVILDNGG..VHRIHRSLKYIGVSSKIVPNTTPLEEIESNKEVKGIILSGGPDIEKAKNCIDIALNAKLPILGICLGHQLIALAYGGEVGRAEAEEYAL -------110-------120-------130-------140-------150-------160-------170-------180-------- TKVYVDKENDLFKNVPREFNAWASHKDEVKKVPEGFEILAHSDICQVEAMKHKTKPIYGVQFHPEVAHTEYGNEILKNFCKVCGYKFE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||| | ||||||||||||||||| TKVYVDKENDLFKNVPREFNAWASHKDEVKKVPEGFEILAHSDICQVEAMKHKTKPIYGVQF.PEVA.T..GNEILKNFCKVCGYKFE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MIVILDNGGQYVHRIHRSLKYIGVSSKIVPNTTPLEEIESNKEVKGIILSGGPDIEKAKNCIDIALNAKLPILGICLGHQLIALAYGGEVGRAEAEEYAL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MIVILDNGGQYVHRIHRSLKYIGVSSKIVPNTTPLEEIESNKEVKGIILSGGPDIEKAKNCIDIALNAKLPILGICLGHQLIALAYGGEVGRAEAEEYAL -------110-------120-------130-------140-------150-------160-------170-------180-------- TKVYVDKENDLFKNVPREFNAWASHKDEVKKVPEGFEILAHSDICQVEAMKHKTKPIYGVQFHPEVAHTEYGNEILKNFCKVCGYKFE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TKVYVDKENDLFKNVPREFNAWASHKDEVKKVPEGFEILAHSDICQVEAMKHKTKPIYGVQFHPEVAHTEYGNEILKNFCKVCGYKFE