N/A
SDPKKKMCKE RIPQPKNTVA MLNELRHGLI YKLESQTGPV HAPLFTISVE VDGQKYLGQG RSKKVARIEA AATALRSFIQ FKDGAVLSPL KPA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 75.8 % (838 of 1106) | 81.5 % (476 of 584) | 66.4 % (285 of 429) | 82.8 % (77 of 93) |
Backbone | 72.4 % (394 of 544) | 85.4 % (158 of 185) | 60.8 % (166 of 273) | 81.4 % (70 of 86) |
Sidechain | 80.0 % (519 of 649) | 79.7 % (318 of 399) | 79.8 % (194 of 243) | 100.0 % (7 of 7) |
Aromatic | 81.5 % (44 of 54) | 100.0 % (27 of 27) | 63.0 % (17 of 27) | |
Methyl | 94.3 % (100 of 106) | 94.3 % (50 of 53) | 94.3 % (50 of 53) |
1. dADAR-dsRBD1
SDPKKKMCKE RIPQPKNTVA MLNELRHGLI YKLESQTGPV HAPLFTISVE VDGQKYLGQG RSKKVARIEA AATALRSFIQ FKDGAVLSPL KPASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | dADAR-dsRBD1 | [U-15N] | 0.8 ~ 1.2 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | dADAR-dsRBD1 | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | dADAR-dsRBD1 | [U-15N] | 0.8 ~ 1.2 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | dADAR-dsRBD1 | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | dADAR-dsRBD1 | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | dADAR-dsRBD1 | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | dADAR-dsRBD1 | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | dADAR-dsRBD1 | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | dADAR-dsRBD1 | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | dADAR-dsRBD1 | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | dADAR-dsRBD1 | [U-15N] | 0.8 ~ 1.2 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | dADAR-dsRBD1 | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | dADAR-dsRBD1 | [U-13C; U-15N] | 0.8 ~ 1.2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17936_2ljh.nef |
Input source #2: Coordindates | 2ljh.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--30--------40--------50--------60--------70--------80--------90-------100-------110-------120------ MGSSHHHHHHSSGLVPRGSHMSDPKKKMCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMSDPKKKMCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -130-------140 QFKDGAVLSPLKPA |||||||||||||| QFKDGAVLSPLKPA -------110----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
Content subtype: combined_17936_2ljh.nef
Assigned chemical shifts
--30--------40--------50--------60--------70--------80--------90-------100-------110-------120------ MGSSHHHHHHSSGLVPRGSHMSDPKKKMCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFI ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ................................IPQ..NTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFI -130-------140 QFKDGAVLSPLKPA ||||||||||| || QFKDGAVLSPL.PA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 697 | 457 | 65.6 |
13C chemical shifts | 516 | 263 | 51.0 |
15N chemical shifts | 119 | 75 | 63.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 229 | 154 | 67.2 |
13C chemical shifts | 228 | 78 | 34.2 |
15N chemical shifts | 106 | 67 | 63.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 468 | 303 | 64.7 |
13C chemical shifts | 288 | 185 | 64.2 |
15N chemical shifts | 13 | 8 | 61.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 51 | 83.6 |
13C chemical shifts | 61 | 51 | 83.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 27 | 65.9 |
13C chemical shifts | 41 | 17 | 41.5 |
Distance restraints
--30--------40--------50--------60--------70--------80--------90-------100-------110-------120------ MGSSHHHHHHSSGLVPRGSHMSDPKKKMCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFI ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ................................IPQ..NTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFI -130-------140 QFKDGAVLSPLKPA ||||||||||| || QFKDGAVLSPL.PA