1H, 13C and 15N resonance assignment of a complex constisting of hDlg/SAP-97 residues 318-406 and HPV type 51 E6 protein residues 141-151
MEIKLIKGPK GLGFSIAGGV GNQHIPGDNS IYVTKIIEGG AAHKDGKLQI GDKLLAVNNV CLEEVTHEEA VTALKNTSDF VYLKVAKPTG SHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.3 % (1173 of 1218) | 96.4 % (608 of 631) | 96.4 % (456 of 473) | 95.6 % (109 of 114) |
Backbone | 97.3 % (619 of 636) | 97.3 % (217 of 223) | 98.1 % (303 of 309) | 95.2 % (99 of 104) |
Sidechain | 95.6 % (647 of 677) | 95.8 % (391 of 408) | 95.0 % (246 of 259) | 100.0 % (10 of 10) |
Aromatic | 72.2 % (52 of 72) | 72.2 % (26 of 36) | 72.2 % (26 of 36) | |
Methyl | 100.0 % (128 of 128) | 100.0 % (64 of 64) | 100.0 % (64 of 64) |
1. hDlg
MEIKLIKGPK GLGFSIAGGV GNQHIPGDNS IYVTKIIEGG AAHKDGKLQI GDKLLAVNNV CLEEVTHEEA VTALKNTSDF VYLKVAKPTG SHHHHHH2. E6 protein fragment of HPV type 51
XRTRQRNETQ VSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 4 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | TCEP | natural abundance | 4 mM | |
10 | sodium azide | natural abundance | 0.05 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hDlg | natural abundance | 3 mM | |
12 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | TCEP | natural abundance | 4 mM | |
15 | sodium azide | natural abundance | 0.05 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | hDlg | natural abundance | 3 mM | |
17 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
18 | sodium phosphate | natural abundance | 20 mM | |
19 | TCEP | natural abundance | 4 mM | |
20 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 4 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 4 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 4 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 4 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 4 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 4 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 4 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 4 mM | |
5 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | TCEP | natural abundance | 4 mM | |
10 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | TCEP | natural abundance | 4 mM | |
10 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | TCEP | natural abundance | 4 mM | |
10 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | TCEP | natural abundance | 4 mM | |
10 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | TCEP | natural abundance | 4 mM | |
10 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hDlg | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | E6 protein fragment of HPV type 51 | natural abundance | 2 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | TCEP | natural abundance | 4 mM | |
10 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hDlg | natural abundance | 3 mM | |
12 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | TCEP | natural abundance | 4 mM | |
15 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hDlg | natural abundance | 3 mM | |
12 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | TCEP | natural abundance | 4 mM | |
15 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hDlg | natural abundance | 3 mM | |
12 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | TCEP | natural abundance | 4 mM | |
15 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hDlg | natural abundance | 3 mM | |
12 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | TCEP | natural abundance | 4 mM | |
15 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hDlg | natural abundance | 3 mM | |
12 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | TCEP | natural abundance | 4 mM | |
15 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hDlg | natural abundance | 3 mM | |
12 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | TCEP | natural abundance | 4 mM | |
15 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hDlg | natural abundance | 3 mM | |
12 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | TCEP | natural abundance | 4 mM | |
15 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hDlg | natural abundance | 3 mM | |
12 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
13 | sodium phosphate | natural abundance | 20 mM | |
14 | TCEP | natural abundance | 4 mM | |
15 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | hDlg | natural abundance | 3 mM | |
17 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
18 | sodium phosphate | natural abundance | 20 mM | |
19 | TCEP | natural abundance | 4 mM | |
20 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | hDlg | natural abundance | 3 mM | |
17 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
18 | sodium phosphate | natural abundance | 20 mM | |
19 | TCEP | natural abundance | 4 mM | |
20 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | hDlg | natural abundance | 3 mM | |
17 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
18 | sodium phosphate | natural abundance | 20 mM | |
19 | TCEP | natural abundance | 4 mM | |
20 | sodium azide | natural abundance | 0.05 % |
Bruker Avance - 600 MHz cryo-probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | hDlg | natural abundance | 3 mM | |
17 | E6 protein fragment of HPV type 51 | [U-100% 13C; U-100% 15N] | 1.25 mM | |
18 | sodium phosphate | natural abundance | 20 mM | |
19 | TCEP | natural abundance | 4 mM | |
20 | sodium azide | natural abundance | 0.05 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17942_2m3m.nef |
Input source #2: Coordindates | 2m3m.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
2:1:PCA:C | 2:2:ARG:N | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 141 | PCA | PYROGLUTAMIC ACID | Assigned chemical shifts, Distance restraints, Torsion angle restraints, Coordinates |
Sequence alignments
--320-----330-------340-------350-------360-------370-------380-------390-------400-------410---- MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------
-------150- XRTRQRNETQV ||||||||||| XRTRQRNETQV --------10-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 97 | 0 | 0 | 100.0 |
B | B | 11 | 0 | 0 | 100.0 |
Content subtype: combined_17942_2m3m.nef
Assigned chemical shifts
--320-----330-------340-------350-------360-------370-------380-------390-------400-------410---- MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHH --320-----330-------340-------350-------360-------370-------380-------390-------400-------410-
-------150- XRTRQRNETQV ||||||||||| XRTRQRNETQV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 563 | 537 | 95.4 |
13C chemical shifts | 430 | 408 | 94.9 |
15N chemical shifts | 101 | 96 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 203 | 196 | 96.6 |
13C chemical shifts | 194 | 188 | 96.9 |
15N chemical shifts | 94 | 89 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 360 | 341 | 94.7 |
13C chemical shifts | 236 | 220 | 93.2 |
15N chemical shifts | 7 | 7 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 60 | 98.4 |
13C chemical shifts | 61 | 60 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 24 | 66.7 |
13C chemical shifts | 36 | 24 | 66.7 |
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
141 | PCA | C | 177.884 |
141 | PCA | CD | 177.617 |
145 | GLN | CD | 180.462 |
146 | ARG | CZ | 159.566 |
147 | ASN | CG | 176.517 |
150 | GLN | CD | 180.162 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 71 | 95.9 |
13C chemical shifts | 46 | 46 | 100.0 |
15N chemical shifts | 17 | 15 | 88.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 21 | 95.5 |
13C chemical shifts | 21 | 21 | 100.0 |
15N chemical shifts | 11 | 11 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 50 | 96.2 |
13C chemical shifts | 25 | 25 | 100.0 |
15N chemical shifts | 6 | 4 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 4 | 4 | 100.0 |
13C chemical shifts | 4 | 4 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Covalent bonds
Distance restraints
--320-----330-------340-------350-------360-------370-------380-------390-------400-------410---- MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHH --320-----330-------340-------350-------360-------370-------380-------390-------400-------410-
-------150- XRTRQRNETQV ||||||||||| XRTRQRNETQV
--320-----330-------340-------350-------360-------370-------380-------390-------400-------410---- MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKP....H --320-----330-------340-------350-------360-------370-------380-------390-------400-------410
-------150- XRTRQRNETQV ||||||||| ..TRQRNETQV
Dihedral angle restraints
--320-----330-------340-------350-------360-------370-------380-------390-------400-------410---- MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHH --320-----330-------340-------350-------360-------370-------380-------390-------400-------410-
-------150- XRTRQRNETQV ||||||||||| XRTRQRNETQV