(C9S, C14S)-leucocin A
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.3 % (354 of 401) | 88.7 % (181 of 204) | 85.1 % (131 of 154) | 97.7 % (42 of 43) |
Backbone | 98.2 % (218 of 222) | 97.6 % (80 of 82) | 99.0 % (102 of 103) | 97.3 % (36 of 37) |
Sidechain | 79.3 % (165 of 208) | 82.8 % (101 of 122) | 72.5 % (58 of 80) | 100.0 % (6 of 6) |
Aromatic | 38.2 % (26 of 68) | 41.2 % (14 of 34) | 31.3 % (10 of 32) | 100.0 % (2 of 2) |
Methyl | 100.0 % (24 of 24) | 100.0 % (12 of 12) | 100.0 % (12 of 12) |
1. entity
KYYGNGVHST KSGSSVNWGE AFSAGVHRLA NGGNGFWSolvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Varian INOVA - 800 MHz NANUC
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Varian INOVA - 600 MHz i600
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Varian INOVA - 800 MHz NANUC
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Varian INOVA - 600 MHz i600
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Varian INOVA - 800 MHz NANUC
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Varian INOVA - 600 MHz i600
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Varian INOVA - 600 MHz i600
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Varian INOVA - 800 MHz NANUC
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Varian INOVA - 800 MHz NANUC
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Varian INOVA - 800 MHz NANUC
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | peptide | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | DSS | natural abundance | 100 uM | |
3 | trifluoroethanol | natural abundance | ||
4 | H2O | natural abundance |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17955_2ljq.nef |
Input source #2: Coordindates | 2ljq.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30------- KYYGNGVHSTKSGSSVNWGEAFSAGVHRLANGGNGFW ||||||||||||||||||||||||||||||||||||| KYYGNGVHSTKSGSSVNWGEAFSAGVHRLANGGNGFW
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 37 | 0 | 0 | 100.0 |
Content subtype: combined_17955_2ljq.nef
Assigned chemical shifts
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
5 | ASN | CG | 176.655 |
17 | ASN | CG | 176.416 |
28 | ARG | HH22 | 7.015 |
28 | ARG | HH21 | 6.87 |
28 | ARG | NH2 | 123.391 |
31 | ASN | CG | 177.342 |
34 | ASN | CG | 176.658 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 204 | 182 | 89.2 |
13C chemical shifts | 154 | 131 | 85.1 |
15N chemical shifts | 44 | 42 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 81 | 98.8 |
13C chemical shifts | 74 | 73 | 98.6 |
15N chemical shifts | 37 | 36 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 122 | 101 | 82.8 |
13C chemical shifts | 80 | 58 | 72.5 |
15N chemical shifts | 7 | 6 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 12 | 12 | 100.0 |
13C chemical shifts | 12 | 12 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 14 | 41.2 |
13C chemical shifts | 32 | 10 | 31.2 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30------- KYYGNGVHSTKSGSSVNWGEAFSAGVHRLANGGNGFW ||||||||||||||||||||||||||||||||||||| KYYGNGVHSTKSGSSVNWGEAFSAGVHRLANGGNGFW
Dihedral angle restraints
--------10--------20--------30------- KYYGNGVHSTKSGSSVNWGEAFSAGVHRLANGGNGFW ||||||||||||||||||||||||||| .....GVHSTKSGSSVNWGEAFSAGVHRLANG --------10--------20--------30--