C9L,C14L-LeuA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.9 % (326 of 413) | 77.6 % (163 of 210) | 78.8 % (126 of 160) | 86.0 % (37 of 43) |
Backbone | 98.6 % (219 of 222) | 97.6 % (80 of 82) | 99.0 % (102 of 103) | 100.0 % (37 of 37) |
Sidechain | 61.8 % (136 of 220) | 64.8 % (83 of 128) | 61.6 % (53 of 86) | 0.0 % (0 of 6) |
Aromatic | 0.0 % (0 of 68) | 0.0 % (0 of 34) | 0.0 % (0 of 32) | 0.0 % (0 of 2) |
Methyl | 100.0 % (32 of 32) | 100.0 % (16 of 16) | 100.0 % (16 of 16) |
1. entity
KYYGNGVHLT KSGLSVNWGE AFSAGVHRLA NGGNGFWSolvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Varian VNMRS - 700 MHz v700
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Varian VNMRS - 700 MHz v700
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Varian VNMRS - 700 MHz v700
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Varian VNMRS - 700 MHz v700
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Varian VNMRS - 700 MHz v700
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Varian VNMRS - 700 MHz v700
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Varian VNMRS - 700 MHz v700
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Varian VNMRS - 700 MHz v700
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Varian VNMRS - 700 MHz v700
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Varian VNMRS - 700 MHz v700
State isotropic, Solvent system trifluoroethanol/water, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C9L,C14L-LeuA | [U-13C; U-15N] | 0.6 mM | |
2 | TFE | [U-2H] | 90 % | |
3 | H2O | natural abundance | 10 % | |
4 | TFA | natural abundance | 0.1 % | |
5 | DSS | natural abundance | 2.6 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17958_2ljt.nef |
Input source #2: Coordindates | 2ljt.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30------- KYYGNGVHLTKSGLSVNWGEAFSAGVHRLANGGNGFW ||||||||||||||||||||||||||||||||||||| KYYGNGVHLTKSGLSVNWGEAFSAGVHRLANGGNGFW
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 37 | 0 | 0 | 100.0 |
Content subtype: combined_17958_2ljt.nef
Assigned chemical shifts
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 210 | 162 | 77.1 |
13C chemical shifts | 160 | 126 | 78.7 |
15N chemical shifts | 44 | 36 | 81.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 79 | 96.3 |
13C chemical shifts | 74 | 73 | 98.6 |
15N chemical shifts | 37 | 36 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 128 | 83 | 64.8 |
13C chemical shifts | 86 | 53 | 61.6 |
15N chemical shifts | 7 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 16 | 16 | 100.0 |
13C chemical shifts | 16 | 16 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 0 | 0.0 |
13C chemical shifts | 32 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
Dihedral angle restraints
--------10--------20--------30------- KYYGNGVHLTKSGLSVNWGEAFSAGVHRLANGGNGFW ||||||||||||||||||||||||| .....GVHLTKSGLSVNWGEAFSAGVHRLA --------10--------20--------30