1H,13C, and 15N chemical shift assignments for human endothelial monocyte-activating polypeptide II
AMDSKPIDVS RLDLRIGCII TARKHPDADS LYVEEVDVGE IAPRTVVSGL VNHVPLEQMQ NRMVILLCNL KPAKMRGVLS QAMVMCASSP EKIEILAPPN GSVPGDRITF DAFPGEPDKE LNPKKKIWEQ IQPDLHTNDE CVATYKGVPF EVKGKGVCRA QTMSNSGIK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.6 % (1623 of 1941) | 90.1 % (917 of 1018) | 74.0 % (558 of 754) | 87.6 % (148 of 169) |
Backbone | 82.5 % (813 of 986) | 95.8 % (321 of 335) | 69.8 % (346 of 496) | 94.2 % (146 of 155) |
Sidechain | 86.5 % (963 of 1113) | 87.3 % (596 of 683) | 87.7 % (365 of 416) | 14.3 % (2 of 14) |
Aromatic | 14.3 % (10 of 70) | 17.1 % (6 of 35) | 8.8 % (3 of 34) | 100.0 % (1 of 1) |
Methyl | 97.9 % (190 of 194) | 96.9 % (94 of 97) | 99.0 % (96 of 97) |
1. emap II
AMDSKPIDVS RLDLRIGCII TARKHPDADS LYVEEVDVGE IAPRTVVSGL VNHVPLEQMQ NRMVILLCNL KPAKMRGVLS QAMVMCASSP EKIEILAPPN GSVPGDRITF DAFPGEPDKE LNPKKKIWEQ IQPDLHTNDE CVATYKGVPF EVKGKGVCRA QTMSNSGIKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian Uniform NMR System - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Varian Uniform NMR System - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Varian Uniform NMR System - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Varian Uniform NMR System - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Varian Uniform NMR System - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Varian Uniform NMR System - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Varian Uniform NMR System - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Varian Uniform NMR System - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Varian Uniform NMR System - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Varian Uniform NMR System - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Varian Uniform NMR System - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 (±0.2) K, pH 8.0 (±0.3)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | emap II | [U-98% 13C; U-98% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 250 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr18045_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AMDSKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPN |||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| .....PIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLV.HVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPP. -------110-------120-------130-------140-------150-------160--------- GSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
18 | CYS | HG | 2.13 |
68 | CYS | HG | 2.0 |
86 | CYS | HG | 2.03 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1018 | 897 | 88.1 |
13C chemical shifts | 754 | 518 | 68.7 |
15N chemical shifts | 177 | 139 | 78.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 335 | 312 | 93.1 |
13C chemical shifts | 338 | 161 | 47.6 |
15N chemical shifts | 155 | 138 | 89.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 683 | 585 | 85.7 |
13C chemical shifts | 416 | 357 | 85.8 |
15N chemical shifts | 22 | 1 | 4.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 104 | 102 | 98.1 |
13C chemical shifts | 104 | 97 | 93.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 3 | 8.6 |
13C chemical shifts | 34 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |