Solution NMR Structure of Lysine-specific demethylase lid from Drosophila melanogaster, Northeast Structural Genomics Consortium Target FR824D
PRVQRLNELE AKTRVKLNFL DQIAKFWELQ GSSLKIPMVE RKALDLYTLH RIVQEEGGME QTTKDRKWAK VANRMQYPSS KSVGATLKAH YERILHPFEV YTSGKVL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.5 % (1209 of 1321) | 90.9 % (633 of 696) | 90.6 % (463 of 511) | 99.1 % (113 of 114) |
Backbone | 97.2 % (616 of 634) | 97.2 % (209 of 215) | 96.5 % (305 of 316) | 99.0 % (102 of 103) |
Sidechain | 87.8 % (693 of 789) | 88.1 % (424 of 481) | 86.9 % (258 of 297) | 100.0 % (11 of 11) |
Aromatic | 65.3 % (64 of 98) | 77.6 % (38 of 49) | 51.1 % (24 of 47) | 100.0 % (2 of 2) |
Methyl | 91.8 % (112 of 122) | 93.4 % (57 of 61) | 90.2 % (55 of 61) |
1. FR824D
PRVQRLNELE AKTRVKLNFL DQIAKFWELQ GSSLKIPMVE RKALDLYTLH RIVQEEGGME QTTKDRKWAK VANRMQYPSS KSVGATLKAH YERILHPFEV YTSGKVLSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FR824D | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.3 mM [U-5% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FR824D | [U-5% 13C; U-100% 15N] | 1.3 mM | |
7 | sodium chloride | natural abundance | 100 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | sodium azide | natural abundance | 0.02 % | |
10 | TRIS | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FR824D | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FR824D | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FR824D | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FR824D | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FR824D | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FR824D | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.3 mM [U-5% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FR824D | [U-5% 13C; U-100% 15N] | 1.3 mM | |
7 | sodium chloride | natural abundance | 100 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | sodium azide | natural abundance | 0.02 % | |
10 | TRIS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FR824D | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.2 mM [U-100% 13C; U-100% 15N] FR824D, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FR824D | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | TRIS | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18095_2lm1.nef |
Input source #2: Coordindates | 2lm1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----220-------230-------240-------250-------260-------270-------280-------290-------300-------310--- PRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPSSKSVGATLKAHYERILHPFEV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPSSKSVGATLKAHYERILHPFEV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ----320 YTSGKVL ||||||| YTSGKVL -------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 107 | 0 | 0 | 100.0 |
Content subtype: combined_18095_2lm1.nef
Assigned chemical shifts
----220-------230-------240-------250-------260-------270-------280-------290-------300-------310--- PRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPSSKSVGATLKAHYERILHPFEV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||| PRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPS.KSVGATLKAHYERILHPFEV ----320 YTSGKVL ||||||| YTSGKVL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 696 | 636 | 91.4 |
13C chemical shifts | 511 | 464 | 90.8 |
15N chemical shifts | 122 | 112 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 215 | 212 | 98.6 |
13C chemical shifts | 214 | 207 | 96.7 |
15N chemical shifts | 103 | 101 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 481 | 424 | 88.1 |
13C chemical shifts | 297 | 257 | 86.5 |
15N chemical shifts | 19 | 11 | 57.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 56 | 87.5 |
13C chemical shifts | 64 | 56 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 35 | 71.4 |
13C chemical shifts | 47 | 21 | 44.7 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
----220-------230-------240-------250-------260-------270-------280-------290-------300-------310--- PRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPSSKSVGATLKAHYERILHPFEV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||| .RVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPS.KSVGATLKAHYERILHPFEV ----320 YTSGKVL ||||||| YTSGKVL
Dihedral angle restraints
----220-------230-------240-------250-------260-------270-------280-------290-------300-------310--- PRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQYPSSKSVGATLKAHYERILHPFEV |||||||||||||| |||||||||| ||||||||| ||||||||| |||||||||||||||||||| .............RVKLNFLDQIAKFW...................YTLHRIVQEE.GMEQTTKDR.WAKVANRMQ....KSVGATLKAHYERILHPFEV ----220-------230-------240-------250-------260-------270-------280-------290-------300-------310--- ----320 YTSGKVL ||| YTS ---