Solution NMR Structure of mitochondrial succinate dehydrogenase assembly factor 2 from Saccharomyces cerevisiae, Northeast Structural Genomics Consortium Target YT682A
MGHHHHHHSH MIKRTNEPLD KKRARLIYQS RKRGILETDL LLSGFAAKYL KKMNEEELEE YDSLLNELDW DIYYWATKNF KTSPLPDKWA NSKLLKQLQE FSENKEKEI
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.9 % (1281 of 1379) | 92.6 % (676 of 730) | 93.2 % (495 of 531) | 93.2 % (110 of 118) |
Backbone | 92.6 % (600 of 648) | 91.7 % (200 of 218) | 93.2 % (302 of 324) | 92.5 % (98 of 106) |
Sidechain | 93.3 % (781 of 837) | 93.0 % (476 of 512) | 93.6 % (293 of 313) | 100.0 % (12 of 12) |
Aromatic | 82.1 % (110 of 134) | 82.1 % (55 of 67) | 81.3 % (52 of 64) | 100.0 % (3 of 3) |
Methyl | 100.0 % (98 of 98) | 100.0 % (49 of 49) | 100.0 % (49 of 49) |
1. YT682A
MGHHHHHHSH MIKRTNEPLD KKRARLIYQS RKRGILETDL LLSGFAAKYL KKMNEEELEE YDSLLNELDW DIYYWATKNF KTSPLPDKWA NSKLLKQLQE FSENKEKEISolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [5% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | YT682A | [5% 13C; U-100% 15N] | 1.1 mM | |
9 | MES | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | calcium chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | DSS | natural abundance | 50 uM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [5% 13C; U-100% 15N] YT682A aligned in PEG, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | YT682A | [5% 13C; U-100% 15N] | 0.7 mM | |
16 | MES | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | DTT | natural abundance | 10 mM | |
20 | sodium azide | natural abundance | 0.02 % | |
21 | DSS | natural abundance | 50 uM | |
22 | C12E5 PEG | natural abundance | 4 % | |
23 | hexanol | natural abundance | 4 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [5% 13C; U-100% 15N] YT682A aligned in positively charged compressed gel, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
24 | YT682A | [5% 13C; U-100% 15N] | 1.1 mM | |
25 | MES | natural abundance | 20 mM | |
26 | sodium chloride | natural abundance | 100 mM | |
27 | calcium chloride | natural abundance | 5 mM | |
28 | DTT | natural abundance | 10 mM | |
29 | sodium azide | natural abundance | 0.02 % | |
30 | DSS | natural abundance | 50 uM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 6.5
Experiment name 2D J-resolved 1H-15N HSQC
List #1 PEG, RDC code DHN, Field strength (1H) 599.5202 MHz
List #2 GEL, RDC code DHN, Field strength (1H) 599.5202 MHz
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YT682A | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [5% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | YT682A | [5% 13C; U-100% 15N] | 1.1 mM | |
9 | MES | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | calcium chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [5% 13C; U-100% 15N] YT682A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | YT682A | [5% 13C; U-100% 15N] | 1.1 mM | |
9 | MES | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | calcium chloride | natural abundance | 5 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [5% 13C; U-100% 15N] YT682A aligned in PEG, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | YT682A | [5% 13C; U-100% 15N] | 0.7 mM | |
16 | MES | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | DTT | natural abundance | 10 mM | |
20 | sodium azide | natural abundance | 0.02 % | |
21 | DSS | natural abundance | 50 uM | |
22 | C12E5 PEG | natural abundance | 4 % | |
23 | hexanol | natural abundance | 4 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [5% 13C; U-100% 15N] YT682A aligned in positively charged compressed gel, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
24 | YT682A | [5% 13C; U-100% 15N] | 1.1 mM | |
25 | MES | natural abundance | 20 mM | |
26 | sodium chloride | natural abundance | 100 mM | |
27 | calcium chloride | natural abundance | 5 mM | |
28 | DTT | natural abundance | 10 mM | |
29 | sodium azide | natural abundance | 0.02 % | |
30 | DSS | natural abundance | 50 uM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18098_2lm4.nef |
Input source #2: Coordindates | 2lm4.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQE --------- FSENKEKEI ||||||||| FSENKEKEI
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 109 | 0 | 0 | 100.0 |
Content subtype: combined_18098_2lm4.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........HMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQE --------- FSENKEKEI ||||||||| FSENKEKEI
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
33 | ARG | HH11 | 6.117 |
33 | ARG | HH12 | 6.117 |
33 | ARG | HH21 | 6.117 |
33 | ARG | HH22 | 6.117 |
61 | TYR | HH | 8.542 |
77 | THR | HG1 | 3.92 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 730 | 676 | 92.6 |
13C chemical shifts | 531 | 488 | 91.9 |
15N chemical shifts | 123 | 111 | 90.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 218 | 198 | 90.8 |
13C chemical shifts | 218 | 199 | 91.3 |
15N chemical shifts | 106 | 95 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 512 | 478 | 93.4 |
13C chemical shifts | 313 | 289 | 92.3 |
15N chemical shifts | 17 | 16 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 51 | 98.1 |
13C chemical shifts | 52 | 51 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 53 | 79.1 |
13C chemical shifts | 64 | 50 | 78.1 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........MIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQE --------- FSENKEKEI ||||||||| FSENKEKEI
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQE ||||||||||||||||||||||||||||||||||| ||||||||||||| ||||||| ||||||||| .................PLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKK.NEEELEEYDSLLN.LDWDIYY.................SKLLKQLQE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --------- FSENKEKEI ||||| FSENK -----
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQE |||||| | | | |||||| |||||||||||||||| |||||||||| | |||| | ||| ||| ||||| ....................KKRARL.Y.S...G.LETDLL.SGFAAKYLKKMNEEEL.EYDSLLNELD.D.YYWA........L.DKW..SKL.KQLQE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --------- FSENKEKEI || FS --