DocA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.3 % (702 of 714) | 98.1 % (361 of 368) | 98.5 % (266 of 270) | 98.7 % (75 of 76) |
Backbone | 99.3 % (399 of 402) | 99.3 % (142 of 143) | 99.5 % (191 of 192) | 98.5 % (66 of 67) |
Sidechain | 97.6 % (361 of 370) | 97.3 % (219 of 225) | 97.8 % (133 of 136) | 100.0 % (9 of 9) |
Aromatic | 100.0 % (8 of 8) | 100.0 % (4 of 4) | 100.0 % (4 of 4) | |
Methyl | 100.0 % (82 of 82) | 100.0 % (41 of 41) | 100.0 % (41 of 41) |
1. DocA
GSASNTILGD LNDDGVVNGR DIVMMRQYLA GKTVSGIDKN ALDINGDGAV NGRDLMELIK KVSNNTSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DocA | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % w/v | |
6 | DSS | natural abundance | 0.05 % w/v |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr18189_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60------- GSASNTILGDLNDDGVVNGRDIVMMRQYLAGKTVSGIDKNALDINGDGAVNGRDLMELIKKVSNNTS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSASNTILGDLNDDGVVNGRDIVMMRQYLAGKTVSGIDKNALDINGDGAVNGRDLMELIKKVSNNTS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 368 | 361 | 98.1 |
13C chemical shifts | 270 | 266 | 98.5 |
15N chemical shifts | 79 | 76 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 143 | 142 | 99.3 |
13C chemical shifts | 134 | 133 | 99.3 |
15N chemical shifts | 67 | 66 | 98.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 225 | 219 | 97.3 |
13C chemical shifts | 136 | 133 | 97.8 |
15N chemical shifts | 12 | 10 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 41 | 93.2 |
13C chemical shifts | 44 | 41 | 93.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 4 | 4 | 100.0 |
13C chemical shifts | 4 | 4 | 100.0 |