AR55 solubilised in LPPG micelles
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.4 % (661 of 739) | 86.5 % (326 of 377) | 91.1 % (267 of 293) | 98.6 % (68 of 69) |
Backbone | 96.9 % (370 of 382) | 96.3 % (130 of 135) | 96.7 % (178 of 184) | 98.4 % (62 of 63) |
Sidechain | 84.0 % (347 of 413) | 81.0 % (196 of 242) | 87.9 % (145 of 165) | 100.0 % (6 of 6) |
Aromatic | 69.1 % (76 of 110) | 72.7 % (40 of 55) | 64.2 % (34 of 53) | 100.0 % (2 of 2) |
Methyl | 96.6 % (56 of 58) | 96.6 % (28 of 29) | 96.6 % (28 of 29) |
1. AR55
MEEGGDFDNY YGADNQSECE YTDWKSSGAL IPAIYMLVFL LGTTGNGLVL WTVFRKKGHH HHHHSolvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz nanuc
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz nanuc
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz nanuc
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 310 K, pH 5, Details AR55 solubilised in LPPG micelles
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.56 mM | |
2 | LPPG | natural abundance | 72 mM | |
3 | sodium acetate | [U-2H] | 20 mM | |
4 | sodium azide | natural abundance | 1 mM | |
5 | DSS | natural abundance | 1 mM | |
6 | DTT | [U-99% 2H] | 10 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18226_2lov.nef |
Input source #2: Coordindates | 2lov.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60---- MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 64 | 0 | 0 | 100.0 |
Content subtype: combined_18226_2lov.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60---- MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
55 | ARG | HH21 | 6.718 |
55 | ARG | NH2 | 72.042 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 377 | 323 | 85.7 |
13C chemical shifts | 293 | 267 | 91.1 |
15N chemical shifts | 70 | 69 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 135 | 129 | 95.6 |
13C chemical shifts | 128 | 122 | 95.3 |
15N chemical shifts | 63 | 62 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 242 | 194 | 80.2 |
13C chemical shifts | 165 | 145 | 87.9 |
15N chemical shifts | 7 | 7 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 30 | 96.8 |
13C chemical shifts | 31 | 30 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 40 | 72.7 |
13C chemical shifts | 53 | 34 | 64.2 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60---- MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH