Solution NMR Structure of CASP8-associated protein 2 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8150A
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.2 % (812 of 890) | 91.0 % (433 of 476) | 91.4 % (308 of 337) | 92.2 % (71 of 77) |
Backbone | 92.5 % (385 of 416) | 92.9 % (130 of 140) | 92.8 % (193 of 208) | 91.2 % (62 of 68) |
Sidechain | 90.6 % (491 of 542) | 90.2 % (303 of 336) | 90.9 % (179 of 197) | 100.0 % (9 of 9) |
Aromatic | 74.1 % (40 of 54) | 74.1 % (20 of 27) | 73.1 % (19 of 26) | 100.0 % (1 of 1) |
Methyl | 100.0 % (70 of 70) | 100.0 % (35 of 35) | 100.0 % (35 of 35) |
1. HR8150A
SHMKNVIKKK GEIIILWTRN DDRVILLECQ KRGPSSKTFA YLAAKLDKNP NQVSERFQQL MKLFEKSKCRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR8150A.008, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | HR8150A.006 | [U-5% 13C; U-100% 15N] | 0.17 mM | |
12 | NaN3 | natural abundance | 0.02 % | |
13 | DTT | natural abundance | 10 mM | |
14 | CaCL2 | natural abundance | 5 mM | |
15 | NaCL | natural abundance | 100 mM | |
16 | Proteinase Inhibitors | natural abundance | 1 na | |
17 | MES pH 6.5 | natural abundance | 20 mM | |
18 | D2O | natural abundance | 10 % | |
19 | DSS | natural abundance | 50 uM | |
20 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.75 mM HR8150A.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8150A.006 | [U-100% 13C; U-100% 15N] | 0.75 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR8150A.008, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | HR8150A.006 | [U-5% 13C; U-100% 15N] | 0.17 mM | |
12 | NaN3 | natural abundance | 0.02 % | |
13 | DTT | natural abundance | 10 mM | |
14 | CaCL2 | natural abundance | 5 mM | |
15 | NaCL | natural abundance | 100 mM | |
16 | Proteinase Inhibitors | natural abundance | 1 na | |
17 | MES pH 6.5 | natural abundance | 20 mM | |
18 | D2O | natural abundance | 10 % | |
19 | DSS | natural abundance | 50 uM | |
20 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18352_2lr8.nef |
Input source #2: Coordindates | 2lr8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70 SHMKNVIKKKGEIIILWTRNDDRVILLECQKRGPSSKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SHMKNVIKKKGEIIILWTRNDDRVILLECQKRGPSSKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 70 | 0 | 0 | 100.0 |
Content subtype: combined_18352_2lr8.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70 SHMKNVIKKKGEIIILWTRNDDRVILLECQKRGPSSKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....NVIKKKGEIIILWTRNDDRVILLECQKRGPSSKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
18 | THR | HG1 | 5.205 |
38 | THR | HG1 | 5.133 |
57 | PHE | CG | 23.483 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 476 | 431 | 90.5 |
13C chemical shifts | 337 | 307 | 91.1 |
15N chemical shifts | 82 | 70 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 140 | 128 | 91.4 |
13C chemical shifts | 140 | 128 | 91.4 |
15N chemical shifts | 68 | 61 | 89.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 336 | 303 | 90.2 |
13C chemical shifts | 197 | 179 | 90.9 |
15N chemical shifts | 14 | 9 | 64.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 36 | 97.3 |
13C chemical shifts | 37 | 36 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 27 | 20 | 74.1 |
13C chemical shifts | 26 | 19 | 73.1 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70 SHMKNVIKKKGEIIILWTRNDDRVILLECQKRGPSSKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....VIKKKGEIIILWTRNDDRVILLECQKRGPSSKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70 SHMKNVIKKKGEIIILWTRNDDRVILLECQKRGPSSKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSKCR ||||||||||||| |||||||| ||||||||||||||||| .................TRNDDRVILLECQ.......TFAYLAAK....PNQVSERFQQLMKLFEK --------10--------20--------30--------40--------50--------60------