B2 domain of Neisseria meningitidis Pilus assembly protein PilQ
MGSSHHHHHH GLVPRGSHMA SMTGGQQMGR GSKQTNIDFR KDGKNAGIIE LAALGFAGQP DISQQHDHII VTLKNHTLPT TLQRSLDVAD FKTPVQKVTL KRLNNDTQLI ITTAGNWELV NKSAAPGYFT FQVLPKKQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.6 % (1365 of 1594) | 84.4 % (700 of 829) | 87.0 % (534 of 614) | 86.8 % (131 of 151) |
Backbone | 90.8 % (741 of 816) | 90.1 % (255 of 283) | 90.8 % (364 of 401) | 92.4 % (122 of 132) |
Sidechain | 81.7 % (738 of 903) | 81.5 % (445 of 546) | 84.0 % (284 of 338) | 47.4 % (9 of 19) |
Aromatic | 60.0 % (66 of 110) | 61.8 % (34 of 55) | 57.4 % (31 of 54) | 100.0 % (1 of 1) |
Methyl | 94.7 % (142 of 150) | 94.7 % (71 of 75) | 94.7 % (71 of 75) |
1. NmPilQ B2
MGSSHHHHHH GLVPRGSHMA SMTGGQQMGR GSKQTNIDFR KDGKNAGIIE LAALGFAGQP DISQQHDHII VTLKNHTLPT TLQRSLDVAD FKTPVQKVTL KRLNNDTQLI ITTAGNWELV NKSAAPGYFT FQVLPKKQSolvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 90% water/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 6.800, Details B2 500uM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NmPilQ_B2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr18419_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHGLVPRGSHMASMTGGQQMGRGSKQTNIDFRKDGKNAGIIELAALGFAGQPDISQQHDHIIVTLKNHTLPTTLQRSLDVADFKTPVQKVTL || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .............PR..HMASMTGGQQMGRGSKQTNIDFRKDGKNAGIIELAALGFAGQPDISQQHDHIIVTLKNHTLPTTLQRSLDVADFKTPVQKVTL -------110-------120-------130-------- KRLNNDTQLIITTAGNWELVNKSAAPGYFTFQVLPKKQ |||||||||||||||||||||||||||||||||||||| KRLNNDTQLIITTAGNWELVNKSAAPGYFTFQVLPKKQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 829 | 689 | 83.1 |
13C chemical shifts | 614 | 529 | 86.2 |
15N chemical shifts | 156 | 124 | 79.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 283 | 249 | 88.0 |
13C chemical shifts | 276 | 246 | 89.1 |
15N chemical shifts | 132 | 116 | 87.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 546 | 440 | 80.6 |
13C chemical shifts | 338 | 283 | 83.7 |
15N chemical shifts | 24 | 8 | 33.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 79 | 71 | 89.9 |
13C chemical shifts | 79 | 71 | 89.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 32 | 58.2 |
13C chemical shifts | 54 | 31 | 57.4 |
15N chemical shifts | 1 | 1 | 100.0 |