NMR high resolution structures of free Tah1 and Tah1 bound to the Hsp90 C-terminal tail explain how Hsp90 recognizes the R2TP complex
SQFEKQKEQG NSLFKQGLYR EAVHCYDQLI TAQPQNPVGY SNKAMALIKL GEYTQAIQMC QQGLRYTSTA EHVAIRSKLQ YRLELAQGAV GSVQIPVVEV DELPEGYDRS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.7 % (1170 of 1381) | 94.6 % (683 of 722) | 69.6 % (367 of 527) | 90.9 % (120 of 132) |
Backbone | 80.3 % (567 of 706) | 97.5 % (236 of 242) | 64.8 % (226 of 349) | 91.3 % (105 of 115) |
Sidechain | 89.4 % (703 of 786) | 93.1 % (447 of 480) | 83.4 % (241 of 289) | 88.2 % (15 of 17) |
Aromatic | 71.4 % (60 of 84) | 92.9 % (39 of 42) | 50.0 % (21 of 42) | |
Methyl | 95.2 % (120 of 126) | 98.4 % (62 of 63) | 92.1 % (58 of 63) |
1. entity 1
SQFEKQKEQG NSLFKQGLYR EAVHCYDQLI TAQPQNPVGY SNKAMALIKL GEYTQAIQMC QQGLRYTSTA EHVAIRSKLQ YRLELAQGAV GSVQIPVVEV DELPEGYDRS2. entity 2
ADTEMEEVDSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | entity_2 | natural abundance | 1 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | D2O | natural abundance | 100 % |
Bruker AVIII - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AVIII - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AVIII - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AVIII - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AVIII - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AVIII - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AVIII - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AVIII - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AVIII - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | entity_2 | natural abundance | 1 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | D2O | natural abundance | 100 % |
Bruker AVIII - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | entity_2 | natural abundance | 1 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | D2O | natural abundance | 100 % |
Bruker AVIII - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | entity_2 | natural abundance | 1 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | D2O | natural abundance | 100 % |
Bruker AVIII - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | entity_2 | natural abundance | 1 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | D2O | natural abundance | 100 % |
Bruker AVIII - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | entity_2 | natural abundance | 1 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | D2O | natural abundance | 100 % |
Bruker AVIII - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | entity_2 | natural abundance | 1 mM | |
9 | sodium phosphate | natural abundance | 10 mM | |
10 | sodium chloride | natural abundance | 150 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AVIII - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 288 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | sodium phosphate | natural abundance | 10 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18447_2lsv.nef |
Input source #2: Coordindates | 2lsv.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------110- DELPEGYDRS |||||||||| DELPEGYDRS -------110
--------- ADTEMEEVD ||||||||| ADTEMEEVD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 110 | 0 | 0 | 100.0 |
B | B | 9 | 0 | 0 | 100.0 |
Content subtype: combined_18447_2lsv.nef
Assigned chemical shifts
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..FEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEV ------110- DELPEGYDRS |||||||||| DELPEGYDRS
--------- ADTEMEEVD ||||||||| ADTEMEEVD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 677 | 637 | 94.1 |
13C chemical shifts | 492 | 346 | 70.3 |
15N chemical shifts | 128 | 119 | 93.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 224 | 219 | 97.8 |
13C chemical shifts | 220 | 108 | 49.1 |
15N chemical shifts | 106 | 104 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 453 | 418 | 92.3 |
13C chemical shifts | 272 | 238 | 87.5 |
15N chemical shifts | 22 | 15 | 68.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 58 | 95.1 |
13C chemical shifts | 61 | 58 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 39 | 92.9 |
13C chemical shifts | 42 | 21 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 45 | 43 | 95.6 |
13C chemical shifts | 35 | 0 | 0.0 |
15N chemical shifts | 9 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 18 | 16 | 88.9 |
13C chemical shifts | 18 | 0 | 0.0 |
15N chemical shifts | 9 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 27 | 27 | 100.0 |
13C chemical shifts | 17 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 5 | 5 | 100.0 |
13C chemical shifts | 5 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Distance restraints
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..FEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEV ------110- DELPEGYDRS |||||||||| DELPEGYDRS
--------- ADTEMEEVD ||||||||| ADTEMEEVD