pfsub2 solution NMR structure
TSNKKILLNV DKLVDQYLLN LKNNHTSKQE LILVLKGELD LHSKNMKNVI NNAKKNLEKY FKEHFKEFDK ISYDISTPIN FLCIFIPTLF DMNNMDLLKQ ALLILHNDLH EYVENWSFSS TYHTYEADYI KEQDSVYDRS PKKKYIKAS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 65.0 % (1225 of 1884) | 60.1 % (593 of 986) | 68.7 % (503 of 732) | 77.7 % (129 of 166) |
Backbone | 89.0 % (790 of 888) | 87.5 % (259 of 296) | 90.6 % (404 of 446) | 87.0 % (127 of 146) |
Sidechain | 50.0 % (572 of 1144) | 48.4 % (334 of 690) | 54.4 % (236 of 434) | 10.0 % (2 of 20) |
Aromatic | 21.3 % (38 of 178) | 40.4 % (36 of 89) | 2.3 % (2 of 88) | 0.0 % (0 of 1) |
Methyl | 46.4 % (78 of 168) | 51.2 % (43 of 84) | 41.7 % (35 of 84) |
1. pfsub2
TSNKKILLNV DKLVDQYLLN LKNNHTSKQE LILVLKGELD LHSKNMKNVI NNAKKNLEKY FKEHFKEFDK ISYDISTPIN FLCIFIPTLF DMNNMDLLKQ ALLILHNDLH EYVENWSFSS TYHTYEADYI KEQDSVYDRS PKKKYIKASSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | pfsub2 | [U-13C; U-15N] | 0.3 ~ 0.4 mM | |
2 | potassium phosphate | natural abundance | 100 mM | |
3 | sodium azide | natural abundance | 10 mM | |
4 | D2O | natural abundance | 5 % | |
5 | H2O | natural abundance | 95 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18504_2lu1.nef |
Input source #2: Coordindates | 2lu1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 TSNKKILLNVDKLVDQYLLNLKNNHTSKQELILVLKGELDLHSKNMKNVINNAKKNLEKYFKEHFKEFDKISYDISTPINFLCIFIPTLFDMNNMDLLKQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TSNKKILLNVDKLVDQYLLNLKNNHTSKQELILVLKGELDLHSKNMKNVINNAKKNLEKYFKEHFKEFDKISYDISTPINFLCIFIPTLFDMNNMDLLKQ -------110-------120-------130-------140--------- ALLILHNDLHEYVENWSFSSTYHTYEADYIKEQDSVYDRSPKKKYIKAS ||||||||||||||||||||||||||||||||||||||||||||||||| ALLILHNDLHEYVENWSFSSTYHTYEADYIKEQDSVYDRSPKKKYIKAS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 149 | 0 | 0 | 100.0 |
Content subtype: combined_18504_2lu1.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 TSNKKILLNVDKLVDQYLLNLKNNHTSKQELILVLKGELDLHSKNMKNVINNAKKNLEKYFKEHFKEFDKISYDISTPINFLCIFIPTLFDMNNMDLLKQ ||||||||| |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...KKILLNVDK.VDQY..NLKNNHTSKQELILVLKGELDLHSKNMKNVINNAKKNLEKYFKEHFKEFDKISYDISTPINFLCIFIPTLFDMNNMDLLKQ -------110-------120-------130-------140--------- ALLILHNDLHEYVENWSFSSTYHTYEADYIKEQDSVYDRSPKKKYIKAS ||| |||||||||| ||||||||||||||||||| |||||||| ALL.LHNDLHEYVE.......YHTYEADYIKEQDSVYDRS.KKKYIKAS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 732 | 471 | 64.3 |
1H chemical shifts | 986 | 500 | 50.7 |
15N chemical shifts | 167 | 118 | 70.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 298 | 259 | 86.9 |
1H chemical shifts | 296 | 241 | 81.4 |
15N chemical shifts | 146 | 118 | 80.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 434 | 212 | 48.8 |
1H chemical shifts | 690 | 259 | 37.5 |
15N chemical shifts | 21 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 87 | 21 | 24.1 |
1H chemical shifts | 87 | 27 | 31.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 88 | 2 | 2.3 |
1H chemical shifts | 89 | 36 | 40.4 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 TSNKKILLNVDKLVDQYLLNLKNNHTSKQELILVLKGELDLHSKNMKNVINNAKKNLEKYFKEHFKEFDKISYDISTPINFLCIFIPTLFDMNNMDLLKQ ||||| |||| |||||||||||||||| ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....KILLN....VDQY..NLKNNHTSKQELILVL.GELDLHS.NMKNVINNAKKNLEKYFKEHFKEFDKISYDISTPINFLCIFIPTLFDMNNMDLLKQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140--------- ALLILHNDLHEYVENWSFSSTYHTYEADYIKEQDSVYDRSPKKKYIKAS ||| || ||||||| || | ||||||||||| | | |||| ALL.LH.DLHEYVE.......YH.Y.ADYIKEQDSVY.R...K.YIKA -------110-------120-------130-------140--------
Dihedral angle restraints