Solution NMR Structure of Ig like domain (1277-1357) of Obscurin-like protein 1 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8578D
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.2 % (870 of 924) | 94.6 % (457 of 483) | 94.1 % (334 of 355) | 91.9 % (79 of 86) |
Backbone | 93.7 % (463 of 494) | 93.7 % (163 of 174) | 94.6 % (228 of 241) | 91.1 % (72 of 79) |
Sidechain | 94.6 % (476 of 503) | 95.1 % (294 of 309) | 93.6 % (175 of 187) | 100.0 % (7 of 7) |
Aromatic | 78.3 % (36 of 46) | 91.3 % (21 of 23) | 63.6 % (14 of 22) | 100.0 % (1 of 1) |
Methyl | 100.0 % (88 of 88) | 100.0 % (44 of 44) | 100.0 % (44 of 44) |
1. HR8578D
SHMTRVRSTP GGDLELVVHL SGPGGPVRWY KDGERLASQG RVQLEQAGAR QVLRVQGARS GDAGEYLCDA PQDSRIFLVS VEEPSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.52 mM HR8578D.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | HR8578D.006 | [U-5% 13C; U-100% 15N] | 0.52 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | DTT | natural abundance | 5 mM | |
11 | NaN3 | natural abundance | 0.02 % | |
12 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
13 | H20 | natural abundance | 90 % | |
14 | D20 | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 750 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.52 mM HR8578D.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | HR8578D.006 | [U-5% 13C; U-100% 15N] | 0.52 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | DTT | natural abundance | 5 mM | |
11 | NaN3 | natural abundance | 0.02 % | |
12 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
13 | H20 | natural abundance | 90 % | |
14 | D20 | natural abundance | 10 % |
Varian INOVA - 750 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 750 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 750 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 750 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 750 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 750 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 750 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 750 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.52 mM HR8578D.006, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | HR8578D.006 | [U-5% 13C; U-100% 15N] | 0.52 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | DTT | natural abundance | 5 mM | |
11 | NaN3 | natural abundance | 0.02 % | |
12 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
13 | H20 | natural abundance | 90 % | |
14 | D20 | natural abundance | 10 % |
Varian INOVA - 600 MHz NMR facility at SUNY Buffalo
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.56 mM HR8578D.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8578D.005 | [U-100% 13C; U-100% 15N] | 0.56 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | NaN3 | natural abundance | 0.02 % | |
5 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18511_2lu7.nef |
Input source #2: Coordindates | 2lu7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30--------40--------50--------60--------70--------80-- SHMTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SHMTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEP --------10--------20--------30--------40--------50--------60--------70--------80----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 84 | 0 | 0 | 100.0 |
Content subtype: combined_18511_2lu7.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60--------70--------80-- SHMTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEP ||||||||||||||||||||||||||||||||||||| ||||||||||||||||||| |||||||||||||||||||||||| ..MTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQ.RVQLEQAGARQVLRVQGAR.GDAGEYLCDAPQDSRIFLVSVEEP
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 483 | 453 | 93.8 |
13C chemical shifts | 355 | 334 | 94.1 |
15N chemical shifts | 95 | 79 | 83.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 174 | 159 | 91.4 |
13C chemical shifts | 168 | 158 | 94.0 |
15N chemical shifts | 79 | 70 | 88.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 309 | 294 | 95.1 |
13C chemical shifts | 187 | 176 | 94.1 |
15N chemical shifts | 16 | 9 | 56.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 45 | 45 | 100.0 |
13C chemical shifts | 45 | 45 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 23 | 21 | 91.3 |
13C chemical shifts | 22 | 14 | 63.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80-- SHMTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEP ||||||||||||||||||||| ||||||||||||||| ||||||||||||||||||| ||||||||||||||||||||||| ..MTRVRSTPGGDLELVVHLSGP.GPVRWYKDGERLASQ.RVQLEQAGARQVLRVQGAR..DAGEYLCDAPQDSRIFLVSVEEP
Dihedral angle restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80-- SHMTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEP ||||| ||||||| |||||| |||| ||||| |||||| |||||| ||||||||| ...TRVRS....DLELVVH.......VRWYKD.ERLA.....QLEQA...QVLRVQ.......GEYLCD....SRIFLVSVE -0--------10--------20--------30--------40--------50--------60--------70--------80