NMR solution structure of PA1075 from Pseudomonas Aeruginosa
GSHMTEQTST LYAKLLGETA VISWAELQPF FARGALLQVD AALDLVEVAE ALAGDDREKV AAWLSGGGLS KVGEDAAKDF LERDPTLWAV VVAPWVVIQE RAEKATLH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.3 % (1074 of 1203) | 88.2 % (538 of 610) | 89.8 % (431 of 480) | 92.9 % (105 of 113) |
Backbone | 94.5 % (607 of 642) | 95.5 % (211 of 221) | 93.4 % (295 of 316) | 96.2 % (101 of 105) |
Sidechain | 84.9 % (561 of 661) | 84.1 % (327 of 389) | 87.1 % (230 of 264) | 50.0 % (4 of 8) |
Aromatic | 68.1 % (64 of 94) | 68.1 % (32 of 47) | 65.1 % (28 of 43) | 100.0 % (4 of 4) |
Methyl | 97.4 % (152 of 156) | 97.4 % (76 of 78) | 97.4 % (76 of 78) |
1. entity
GSHMTEQTST LYAKLLGETA VISWAELQPF FARGALLQVD AALDLVEVAE ALAGDDREKV AAWLSGGGLS KVGEDAAKDF LERDPTLWAV VVAPWVVIQE RAEKATLHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PA1075 | [U-100% 13C; U-100% 15N] | 0.5-0.7 mM | |
2 | TRIS | natural abundance | 12.5 mM | |
3 | sodium chloride | natural abundance | 75 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18555_2lv5.nef |
Input source #2: Coordindates | 2lv5.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMTEQTSTLYAKLLGETAVISWAELQPFFARGALLQVDAALDLVEVAEALAGDDREKVAAWLSGGGLSKVGEDAAKDFLERDPTLWAVVVAPWVVIQE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMTEQTSTLYAKLLGETAVISWAELQPFFARGALLQVDAALDLVEVAEALAGDDREKVAAWLSGGGLSKVGEDAAKDFLERDPTLWAVVVAPWVVIQE -------- RAEKATLH |||||||| RAEKATLH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_18555_2lv5.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMTEQTSTLYAKLLGETAVISWAELQPFFARGALLQVDAALDLVEVAEALAGDDREKVAAWLSGGGLSKVGEDAAKDFLERDPTLWAVVVAPWVVIQE |||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HMTEQT.TLYAKLLGETAVISWAELQPFFARGALLQVDAALDLVEVAEALAGDDREKVAAWLSGGGLSKVGEDAAKDFLERDPTLWAVVVAPWVVIQE -------- RAEKATLH |||||||| RAEKATLH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 610 | 538 | 88.2 |
13C chemical shifts | 480 | 429 | 89.4 |
15N chemical shifts | 117 | 105 | 89.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 221 | 211 | 95.5 |
13C chemical shifts | 216 | 199 | 92.1 |
15N chemical shifts | 105 | 101 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 389 | 327 | 84.1 |
13C chemical shifts | 264 | 230 | 87.1 |
15N chemical shifts | 12 | 4 | 33.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 79 | 77 | 97.5 |
13C chemical shifts | 79 | 77 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 32 | 68.1 |
13C chemical shifts | 43 | 28 | 65.1 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMTEQTSTLYAKLLGETAVISWAELQPFFARGALLQVDAALDLVEVAEALAGDDREKVAAWLSGGGLSKVGEDAAKDFLERDPTLWAVVVAPWVVIQE ||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MTEQT.TLYAKLLGETAVISWAELQPFFARGALLQVDAALDLVEVAEALAGDDREKVAAWLSGGGLSKVGEDAAKDFLERDPTLWAVVVAPWVVIQE -------- RAEKATLH |||||||| RAEKATLH
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMTEQTSTLYAKLLGETAVISWAELQPFFARGALLQVDAALDLVEVAEALAGDDREKVAAWLSGGGLSKVGEDAAKDFLERDPTLWAVVVAPWVVIQE |||||||| |||||||||||||||||||||||| ||||||||||| ||||||||||| ||||||||||||||||||||||||| ||||||| ........STLYAKLL..TAVISWAELQPFFARGALLQVDAA.DLVEVAEALAG.DREKVAAWLSG.GLSKVGEDAAKDFLERDPTLWAVVV.PWVVIQE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- RAEKATLH | R -