Solution structures of Miz-1 zinc fingers 8 to 10
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.8 % (812 of 969) | 81.4 % (415 of 510) | 86.3 % (320 of 371) | 87.5 % (77 of 88) |
Backbone | 94.1 % (461 of 490) | 94.0 % (157 of 167) | 94.3 % (230 of 244) | 93.7 % (74 of 79) |
Sidechain | 76.5 % (426 of 557) | 75.2 % (258 of 343) | 80.5 % (165 of 205) | 33.3 % (3 of 9) |
Aromatic | 52.6 % (41 of 78) | 53.8 % (21 of 39) | 51.3 % (20 of 39) | |
Methyl | 94.3 % (66 of 70) | 100.0 % (35 of 35) | 88.6 % (31 of 35) |
1. Miz8-10
MKPYVCIHCQ RQFADPGALQ RHVRIHTGEK PCQCVMCGKA FTQASSLIAH VRQHTGEKPY VCERCGKRFV QSSQLANHIR HHDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.66 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.66 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.66 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.66 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Miz8-10 | [U-13C; U-15N] | 0.75 ~ 1.0 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18586_2lvr.nef |
Input source #2: Coordindates | 2lvr.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:26:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:22:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:9:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:6:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--- MKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 83 | 0 | 0 | 100.0 |
Content subtype: combined_18586_2lvr.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--- MKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||| ..PYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQ.SQLANHIRHHD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 510 | 414 | 81.2 |
13C chemical shifts | 371 | 316 | 85.2 |
15N chemical shifts | 95 | 77 | 81.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 167 | 159 | 95.2 |
13C chemical shifts | 166 | 154 | 92.8 |
15N chemical shifts | 79 | 74 | 93.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 343 | 255 | 74.3 |
13C chemical shifts | 205 | 162 | 79.0 |
15N chemical shifts | 16 | 3 | 18.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 35 | 94.6 |
13C chemical shifts | 37 | 31 | 83.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 19 | 48.7 |
13C chemical shifts | 39 | 19 | 48.7 |
Covalent bonds
Distance restraints
Dihedral angle restraints