S4WYILD
MGSSHHHHHH SSGLVPRGSH MISLSGLTSS VESDLDMQQA MLTNKDEKVL KALERTRQLD IPDEKTMPVL MKLLEEAGGN WSYIKLDNYT ALVDAIYSVE DENKQSEGS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.1 % (1134 of 1231) | 92.6 % (592 of 639) | 91.0 % (434 of 477) | 93.9 % (108 of 115) |
Backbone | 92.9 % (602 of 648) | 93.7 % (208 of 222) | 92.2 % (295 of 320) | 93.4 % (99 of 106) |
Sidechain | 91.8 % (629 of 685) | 92.1 % (384 of 417) | 91.1 % (236 of 259) | 100.0 % (9 of 9) |
Aromatic | 62.5 % (40 of 64) | 65.6 % (21 of 32) | 58.1 % (18 of 31) | 100.0 % (1 of 1) |
Methyl | 97.3 % (109 of 112) | 100.0 % (56 of 56) | 94.6 % (53 of 56) |
1. entity
MGSSHHHHHH SSGLVPRGSH MISLSGLTSS VESDLDMQQA MLTNKDEKVL KALERTRQLD IPDEKTMPVL MKLLEEAGGN WSYIKLDNYT ALVDAIYSVE DENKQSEGSSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2O | natural abundance | 95 % | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | DSS | natural abundance | 0.2 mM | |
5 | DTT | natural abundance | 1.0 mM | |
6 | sodium chloride | natural abundance | 50 mM | |
7 | S4WYILD | [U-98% 15N] | 0.8 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2O | natural abundance | 95 % | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | DSS | natural abundance | 0.2 mM | |
5 | DTT | natural abundance | 1.0 mM | |
6 | sodium chloride | natural abundance | 50 mM | |
7 | S4WYILD | [U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2O | natural abundance | 95 % | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | DSS | natural abundance | 0.2 mM | |
5 | DTT | natural abundance | 1.0 mM | |
6 | sodium chloride | natural abundance | 50 mM | |
7 | S4WYILD | [U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2O | natural abundance | 95 % | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | DSS | natural abundance | 0.2 mM | |
5 | DTT | natural abundance | 1.0 mM | |
6 | sodium chloride | natural abundance | 50 mM | |
7 | S4WYILD | [U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2O | natural abundance | 95 % | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | DSS | natural abundance | 0.2 mM | |
5 | DTT | natural abundance | 1.0 mM | |
6 | sodium chloride | natural abundance | 50 mM | |
7 | S4WYILD | [U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 393 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2O | natural abundance | 95 % | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | DSS | natural abundance | 0.2 mM | |
5 | DTT | natural abundance | 1.0 mM | |
6 | sodium chloride | natural abundance | 50 mM | |
7 | S4WYILD | [U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 388 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2O | natural abundance | 95 % | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | DSS | natural abundance | 0.2 mM | |
5 | DTT | natural abundance | 1.0 mM | |
6 | sodium chloride | natural abundance | 50 mM | |
7 | S4WYILD | [U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 383 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2O | natural abundance | 95 % | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | DSS | natural abundance | 0.2 mM | |
5 | DTT | natural abundance | 1.0 mM | |
6 | sodium chloride | natural abundance | 50 mM | |
7 | S4WYILD | [U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2O | natural abundance | 95 % | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | potassium phosphate | natural abundance | 20 mM | |
4 | DSS | natural abundance | 0.2 mM | |
5 | DTT | natural abundance | 1.0 mM | |
6 | sodium chloride | natural abundance | 50 mM | |
7 | S4WYILD | [U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | H2O | natural abundance | 95 % | |
9 | D2O | [U-100% 2H] | 5 % | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DSS | natural abundance | 0.2 mM | |
12 | DTT | natural abundance | 1.0 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | S4WYILD | [U-98% 13C; U-98% 15N] | 0.8 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18672_2lxe.nef |
Input source #2: Coordindates | 2lxe.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMISLSGLTSSVESDLDMQQAMLTNKDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKLDNYTALVDAIYSVE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMISLSGLTSSVESDLDMQQAMLTNKDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKLDNYTALVDAIYSVE --------- DENKQSEGS ||||||||| DENKQSEGS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 109 | 0 | 0 | 100.0 |
Content subtype: combined_18672_2lxe.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMISLSGLTSSVESDLDMQQAMLTNKDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKLDNYTALVDAIYSVE || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..SS.......SGLVPRGSHMISLSGLTSSVESDLDMQQAMLTNKDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKLDNYTALVDAIYSVE --------- DENKQSEGS ||||||||| DENKQSEGS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
89 | TYR | HH | 9.56 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 639 | 577 | 90.3 |
13C chemical shifts | 477 | 418 | 87.6 |
15N chemical shifts | 118 | 105 | 89.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 222 | 198 | 89.2 |
13C chemical shifts | 218 | 189 | 86.7 |
15N chemical shifts | 106 | 94 | 88.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 417 | 379 | 90.9 |
13C chemical shifts | 259 | 229 | 88.4 |
15N chemical shifts | 12 | 11 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 61 | 98.4 |
13C chemical shifts | 62 | 57 | 91.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 18 | 56.2 |
13C chemical shifts | 31 | 17 | 54.8 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMISLSGLTSSVESDLDMQQAMLTNKDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKLDNYTALVDAIYSVE ||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..............VPRGS.MISLSGLTSSVESDLDMQQAMLTNKDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKLDNYTALVDAIYSVE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --------- DENKQSEGS ||||||| DENKQSE -------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMISLSGLTSSVESDLDMQQAMLTNKDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKLDNYTALVDAIYSVE ||||||||||| |||||||||||||||||||||||||||||||||||||||||| |||||||||||| ................................SDLDMQQAMLT.KDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGNWSYIKL..YTALVDAIYSVE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --------- DENKQSEGS