Solution NMR Structure of the eukaryotic RNA recognition motif, RRM1, from the heterogeneous nuclear ribonucleoprotein H from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8614A
SHMGGEGFVV KVRGLPWSCS ADEVQRFFSD CKIQNGAQGI RFIYTREGRP SGEAFVELES EDEVKLALKK DRETMGHRYV EVFKSNNVEM DWVLKHTGPN SPDTANDG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.5 % (1196 of 1240) | 96.8 % (627 of 648) | 95.8 % (458 of 478) | 97.4 % (111 of 114) |
Backbone | 96.6 % (618 of 640) | 96.9 % (216 of 223) | 96.2 % (301 of 313) | 97.1 % (101 of 104) |
Sidechain | 96.6 % (673 of 697) | 96.7 % (411 of 425) | 96.2 % (252 of 262) | 100.0 % (10 of 10) |
Aromatic | 89.3 % (100 of 112) | 91.1 % (51 of 56) | 87.0 % (47 of 54) | 100.0 % (2 of 2) |
Methyl | 98.9 % (89 of 90) | 97.8 % (44 of 45) | 100.0 % (45 of 45) |
1. HR8614A
SHMGGEGFVV KVRGLPWSCS ADEVQRFFSD CKIQNGAQGI RFIYTREGRP SGEAFVELES EDEVKLALKK DRETMGHRYV EVFKSNNVEM DWVLKHTGPN SPDTANDGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM HR8614A.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR8614A.008 | [biosynthetically directed-5% 13C; U-100% 15N] | 0.8 mM | |
8 | MES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | DSS | natural abundance | 50 uM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
14 | MES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | DSS | natural abundance | 50 uM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
14 | MES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
14 | MES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
14 | MES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM HR8614A.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR8614A.008 | [biosynthetically directed-5% 13C; U-100% 15N] | 0.8 mM | |
8 | MES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM HR8614A.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR8614A.008 | [biosynthetically directed-5% 13C; U-100% 15N] | 0.8 mM | |
8 | MES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM HR8614A.007, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8614A.007 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM HR8614A.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR8614A.008 | [biosynthetically directed-5% 13C; U-100% 15N] | 0.8 mM | |
8 | MES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | DSS | natural abundance | 50 uM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM HR8614A.009, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR8614A.008 | [biosynthetically directed-5% 13C; U-100% 15N] | 0.8 mM | |
8 | MES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | DSS | natural abundance | 50 uM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18698_2lxu.nef |
Input source #2: Coordindates | 2lxu.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----10--------20--------30--------40--------50--------60--------70--------80--------90-------100--- SHMGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SHMGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ----110- SPDTANDG |||||||| SPDTANDG --------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_18698_2lxu.nef
Assigned chemical shifts
-----10--------20--------30--------40--------50--------60--------70--------80--------90-------100--- SHMGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPN ----110- SPDTANDG |||||||| SPDTANDG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
28 | GLN | CD | 179.1 |
37 | GLN | CD | 179.6 |
38 | ASN | CG | 178.3 |
41 | GLN | CD | 180.4 |
89 | ASN | CG | 177.3 |
90 | ASN | CG | 175.3 |
103 | ASN | CG | 177.3 |
109 | ASN | CG | 177.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 648 | 629 | 97.1 |
13C chemical shifts | 478 | 458 | 95.8 |
15N chemical shifts | 121 | 113 | 93.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 223 | 217 | 97.3 |
13C chemical shifts | 216 | 206 | 95.4 |
15N chemical shifts | 104 | 100 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 425 | 412 | 96.9 |
13C chemical shifts | 262 | 252 | 96.2 |
15N chemical shifts | 17 | 13 | 76.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 47 | 97.9 |
13C chemical shifts | 48 | 47 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 51 | 91.1 |
13C chemical shifts | 54 | 47 | 87.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-----10--------20--------30--------40--------50--------60--------70--------80--------90-------100--- SHMGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||| ...GGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETM.HRYVEVFKSNNVEMDWVLKHTGPN ----110- SPDTANDG |||||||| SPDTANDG
-----10--------20--------30--------40--------50--------60--------70--------80--------90-------100--- SHMGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPN |||||| | | ||||||||| ||||| || | | | || | ||||||| | || || || | | | || | ||||||||||| .......FVVKVR..P..C.ADEVQRFFS..KIQNG.QG.R.I.T..GR.S.EAFVELE.E..VK.AL.KD.E.M..R.VE.F.SNNVEMDWVLK -----10--------20--------30--------40--------50--------60--------70--------80--------90-------- ----110- SPDTANDG
Dihedral angle restraints
-----10--------20--------30--------40--------50--------60--------70--------80--------90-------100--- SHMGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPN ||||||||||||||||||||| |||||||||||| ||||||||||||||||| |||||||||||||||||||| .......FVVKVRGLPWSCSADEVQRFF.......GAQGIRFIYTRE....GEAFVELESEDEVKLAL........HRYVEVFKSNNVEMDWVLKH -----10--------20--------30--------40--------50--------60--------70--------80--------90--------- ----110- SPDTANDG