Solution struture of cofilin like UNC-60B protein from Caenorhabditis elegans
MASGVKVDPS CKNAYDLLHN KHQHSYIIFK IDKNDTAIVV EKVGEKNAPY AEFVEEMKKL VEDGKECRYA AVDVEVTVQR QGAEGTSTLN KVIFVQYCPD NAPVRRRMLY ASSVRALKAS LGLESLFQVQ ASEMSDLDEK SVKSDLMSNQ RI
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.3 % (1627 of 1763) | 91.0 % (836 of 919) | 95.0 % (648 of 682) | 88.3 % (143 of 162) |
Backbone | 96.2 % (870 of 904) | 95.8 % (293 of 306) | 96.7 % (435 of 450) | 95.9 % (142 of 148) |
Sidechain | 87.5 % (879 of 1005) | 86.6 % (531 of 613) | 91.8 % (347 of 378) | 7.1 % (1 of 14) |
Aromatic | 83.0 % (83 of 100) | 82.0 % (41 of 50) | 84.0 % (42 of 50) | |
Methyl | 98.8 % (168 of 170) | 100.0 % (85 of 85) | 97.6 % (83 of 85) |
1. entity
MASGVKVDPS CKNAYDLLHN KHQHSYIIFK IDKNDTAIVV EKVGEKNAPY AEFVEEMKKL VEDGKECRYA AVDVEVTVQR QGAEGTSTLN KVIFVQYCPD NAPVRRRMLY ASSVRALKAS LGLESLFQVQ ASEMSDLDEK SVKSDLMSNQ RISolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N LABELED UNC-60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UNC-60B | [U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
14 | sodium phosphate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.1 % | |
17 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N LABELED UNC-60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UNC-60B | [U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
14 | sodium phosphate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.1 % | |
17 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.1 % | |
11 | H2O | natural abundance | 93 % | |
12 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N LABELED UNC-60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UNC-60B | [U-99% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
14 | sodium phosphate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.1 % | |
17 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
14 | sodium phosphate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.1 % | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N 13C labeled UNC60B
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | UNC-60B | [U-99% 13C; U-99% 15N] | 0.9 mM | |
14 | sodium phosphate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.1 % | |
17 | D2O | natural abundance | 100 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr18701_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MASGVKVDPSCKNAYDLLHNKHQHSYIIFKIDKNDTAIVVEKVGEKNAPYAEFVEEMKKLVEDGKECRYAAVDVEVTVQRQGAEGTSTLNKVIFVQYCPD ||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||| MASGVKVDPSCKNAYDLLHNKHQHSYIIFKIDKNDTAIVVEKVGE..APYAEFVEEMKKLVEDGKECRYAAVDVEVTVQRQGAEGTSTLNKVIFVQYCPD -------110-------120-------130-------140-------150-- NAPVRRRMLYASSVRALKASLGLESLFQVQASEMSDLDEKSVKSDLMSNQRI |||||||||||||||||||||||||||||||||||||||||||||||||||| NAPVRRRMLYASSVRALKASLGLESLFQVQASEMSDLDEKSVKSDLMSNQRI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 919 | 835 | 90.9 |
13C chemical shifts | 682 | 646 | 94.7 |
15N chemical shifts | 169 | 144 | 85.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 306 | 299 | 97.7 |
13C chemical shifts | 304 | 297 | 97.7 |
15N chemical shifts | 148 | 144 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 613 | 536 | 87.4 |
13C chemical shifts | 378 | 349 | 92.3 |
15N chemical shifts | 21 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 90 | 85 | 94.4 |
13C chemical shifts | 90 | 83 | 92.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 42 | 84.0 |
13C chemical shifts | 50 | 42 | 84.0 |