Structure of HIV-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidyl-L-serine
GARASVLSGG ELDKWEKIRL RPGGKKQYKL KHIVWASREL ERFAVNPGLL ETSEGCRQIL GQLQPSLQTG SEELRSLYNT IAVLYCVHQR IDVKDTKEAL DKIEEEQNKS KKKAQQAAAD TGNNSQVSQN Y
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.6 % (1321 of 1543) | 91.0 % (742 of 815) | 77.1 % (448 of 581) | 89.1 % (131 of 147) |
Backbone | 84.1 % (656 of 780) | 97.8 % (263 of 269) | 69.2 % (265 of 383) | 100.0 % (128 of 128) |
Sidechain | 88.7 % (784 of 884) | 87.7 % (479 of 546) | 94.7 % (302 of 319) | 15.8 % (3 of 19) |
Aromatic | 85.1 % (63 of 74) | 86.5 % (32 of 37) | 82.9 % (29 of 35) | 100.0 % (2 of 2) |
Methyl | 95.7 % (132 of 138) | 94.2 % (65 of 69) | 97.1 % (67 of 69) |
1. MA
GARASVLSGG ELDKWEKIRL RPGGKKQYKL KHIVWASREL ERFAVNPGLL ETSEGCRQIL GQLQPSLQTG SEELRSLYNT IAVLYCVHQR IDVKDTKEAL DKIEEEQNKS KKKAQQAAAD TGNNSQVSQN YSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MA | [U-95% 13C] | 0.4 mM | |
2 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MA | [U-95% 13C; U-95% 15N] | 0.4 ~ 1.0 mM | |
8 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | DTT | natural abundance | 2 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MA | [U-95% 13C] | 0.4 mM | |
2 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MA | [U-95% 13C] | 0.4 mM | |
2 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MA | [U-95% 13C] | 0.4 mM | |
2 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MA | [U-95% 13C; U-95% 15N] | 0.4 ~ 1.0 mM | |
8 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | DTT | natural abundance | 2 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MA | [U-95% 13C; U-95% 15N] | 0.4 ~ 1.0 mM | |
8 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | DTT | natural abundance | 2 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MA | [U-95% 13C; U-95% 15N] | 0.4 ~ 1.0 mM | |
8 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | DTT | natural abundance | 2 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MA | [U-95% 13C; U-95% 15N] | 0.4 ~ 1.0 mM | |
8 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | DTT | natural abundance | 2 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MA | [U-95% 13C; U-95% 15N] | 0.4 ~ 1.0 mM | |
8 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | DTT | natural abundance | 2 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MA | [U-95% 13C; U-95% 15N] | 0.4 ~ 1.0 mM | |
8 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | DTT | natural abundance | 2 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MA | [U-95% 13C] | 0.4 mM | |
2 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 2 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance II - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MA | [U-95% 13C; U-95% 15N] | 0.4 ~ 1.0 mM | |
8 | 1,2-dioctanoyl-sn-glycero-3-phospho-L-serine, sodium salt | natural abundance | 0.8 ~ 1.0 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | DTT | natural abundance | 2 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18716_2lyb.nef |
Input source #2: Coordindates | 2lyb.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | 8SP | O-[(R)-{[(2R)-2,3-bis(octanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine | None |
Sequence alignments
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEAL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEAL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------110-------120-------130-------- DKIEEEQNKSKKKAQQAAADTGNNSQVSQNYHHHHHH ||||||||||||||||||||||||||||||||||||| DKIEEEQNKSKKKAQQAAADTGNNSQVSQNYHHHHHH -------110-------120-------130-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 137 | 0 | 0 | 100.0 |
Content subtype: combined_18716_2lyb.nef
Assigned chemical shifts
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEAL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEAL -------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- ------110-------120-------130-------- DKIEEEQNKSKKKAQQAAADTGNNSQVSQNYHHHHHH ||||||||||||||||||||||||||||||| DKIEEEQNKSKKKAQQAAADTGNNSQVSQNY ------110-------120-------130--
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 851 | 749 | 88.0 |
13C chemical shifts | 611 | 434 | 71.0 |
15N chemical shifts | 161 | 131 | 81.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 281 | 268 | 95.4 |
13C chemical shifts | 274 | 131 | 47.8 |
15N chemical shifts | 134 | 128 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 570 | 481 | 84.4 |
13C chemical shifts | 337 | 303 | 89.9 |
15N chemical shifts | 27 | 3 | 11.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 69 | 100.0 |
13C chemical shifts | 69 | 69 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 32 | 65.3 |
13C chemical shifts | 47 | 29 | 61.7 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEAL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....VLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEAL -------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- ------110-------120-------130-------- DKIEEEQNKSKKKAQQAAADTGNNSQVSQNYHHHHHH ||||||||||||||||||||| DKIEEEQNKSKKKAQQAAADT ------110-------120--