The solution structure of the Dm DCP1 EVH1 domain in complex with the XRN1 DBM peptide
GPHMADLMAD ESITRMNLAA IKKIDPYAKE IVDSSSHVAF YTFNSSQNEW EKTDVEGAFF IYHRNAEPFH SIFINNRLNT TSFVEPITGS LELQSQPPFL LYRNERSRIR GFWFYNSEEC DRISGLVNGL LKSK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 36.8 % (768 of 2087) | 9.8 % (108 of 1098) | 66.1 % (532 of 805) | 69.6 % (128 of 184) |
Backbone | 55.6 % (558 of 1004) | 12.7 % (43 of 338) | 76.6 % (389 of 508) | 79.7 % (126 of 158) |
Sidechain | 27.4 % (342 of 1247) | 8.6 % (65 of 760) | 59.7 % (275 of 461) | 7.7 % (2 of 26) |
Aromatic | 10.4 % (22 of 212) | 18.9 % (20 of 106) | 1.9 % (2 of 103) | 0.0 % (0 of 3) |
Methyl | 47.4 % (73 of 154) | 10.4 % (8 of 77) | 84.4 % (65 of 77) |
1. Dm DCP1 EVH1 domain
GPHMADLMAD ESITRMNLAA IKKIDPYAKE IVDSSSHVAF YTFNSSQNEW EKTDVEGAFF IYHRNAEPFH SIFINNRLNT TSFVEPITGS LELQSQPPFL LYRNERSRIR GFWFYNSEEC DRISGLVNGL LKSK2. XRN1 DBM
GPQDPLLQQQ RAPFPGQMPN LPKPPLFWQQ EAQKQEALSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Dm_DCP1_EVH1_domain | [U-100% 15N] | 0.4 mM | |
2 | Dm_DCP1_EVH1_domain | [U-100% 13C; U-100% 15N] | 0.7 mM | |
3 | XRN1_DBM | [U-100% 15N] | 0.4 mM | |
4 | XRN1_DBM | [U-100% 13C; U-100% 15N] | 0.7 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18720_2lyd.nef |
Input source #2: Coordindates | 2lyd.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- GPHMADLMADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPHMADLMADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ----100-------110-------120------- LYRNERSRIRGFWFYNSEECDRISGLVNGLLKSK |||||||||||||||||||||||||||||||||| LYRNERSRIRGFWFYNSEECDRISGLVNGLLKSK -------110-------120-------130----
--1320---1330------1340------1350----- GPQDPLLQQQRAPFPGQMPNLPKPPLFWQQEAQKQEAL |||||||||||||||||||||||||||||||||||||| GPQDPLLQQQRAPFPGQMPNLPKPPLFWQQEAQKQEAL --------10--------20--------30--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 134 | 0 | 0 | 100.0 |
B | B | 38 | 0 | 0 | 100.0 |
Content subtype: combined_18720_2lyd.nef
Assigned chemical shifts
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- GPHMADLMADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||| | ......LMADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNR..TTSFVEPITGSLELQSQ...L ----100-------110-------120------- LYRNERSRIRGFWFYNSEECDRISGLVNGLLKSK ||| |||||||| |||||||||||||||||| LYR..RSRIRGFW...SEECDRISGLVNGLLKSK
--1320---1330------1340------1350----- GPQDPLLQQQRAPFPGQMPNLPKPPLFWQQEAQKQEAL || || |||||| |||||||| ||| ..QD......RA...GQMPNL.....FWQQEAQK.EAL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 626 | 451 | 72.0 |
15N chemical shifts | 151 | 108 | 71.5 |
1H chemical shifts | 834 | 18 | 2.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 268 | 218 | 81.3 |
15N chemical shifts | 128 | 108 | 84.4 |
1H chemical shifts | 268 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 358 | 233 | 65.1 |
15N chemical shifts | 23 | 0 | 0.0 |
1H chemical shifts | 566 | 18 | 3.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 67 | 58 | 86.6 |
1H chemical shifts | 67 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 88 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
1H chemical shifts | 90 | 18 | 20.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 179 | 73 | 40.8 |
15N chemical shifts | 42 | 15 | 35.7 |
1H chemical shifts | 264 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 76 | 34 | 44.7 |
15N chemical shifts | 30 | 15 | 50.0 |
1H chemical shifts | 70 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 103 | 39 | 37.9 |
15N chemical shifts | 12 | 0 | 0.0 |
1H chemical shifts | 194 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 14 | 8 | 57.1 |
1H chemical shifts | 14 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 15 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
1H chemical shifts | 16 | 0 | 0.0 |
Distance restraints
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- GPHMADLMADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......MADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFL ----100-------110-------120------- LYRNERSRIRGFWFYNSEECDRISGLVNGLLKSK |||| |||||||| ||||||||||||||||||| LYRN..SRIRGFWF.NSEECDRISGLVNGLLKSK
--1320---1330------1340------1350----- GPQDPLLQQQRAPFPGQMPNLPKPPLFWQQEAQKQEAL ||| |||| |||||||| ||||||||||||| ..QDP....QRAP...QMPNLPKP.LFWQQEAQKQEAL
Dihedral angle restraints
---------------10--------20--------30--------40--------50--------60--------70--------80--------90--- GPHMADLMADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........DESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFL ----100-------110-------120------- LYRNERSRIRGFWFYNSEECDRISGLVNGLLKSK |||||||||||||||||||||||||||||||||| LYRNERSRIRGFWFYNSEECDRISGLVNGLLKSK
--1320---1330------1340------1350----- GPQDPLLQQQRAPFPGQMPNLPKPPLFWQQEAQKQEAL ||||| |||| |||||||||||||||||||||| GPQDP....QRAP..GQMPNLPKPPLFWQQEAQKQEA --1320---1330------1340------1350----