Structure of Faap24 residues 141-215
MGSSHHHHHH SSHMLVPRGS SKNPLLGKKR ALLLSEPSLL RTVQQIPGVG KVKAPLLLQK FPSIQQLSNA SIGELEQVVG QAVAQQIHAF FTQPR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.5 % (892 of 1122) | 78.9 % (465 of 589) | 80.1 % (347 of 433) | 80.0 % (80 of 100) |
Backbone | 87.8 % (488 of 556) | 87.4 % (166 of 190) | 88.5 % (246 of 278) | 86.4 % (76 of 88) |
Sidechain | 73.7 % (482 of 654) | 74.9 % (299 of 399) | 73.7 % (179 of 243) | 33.3 % (4 of 12) |
Aromatic | 35.5 % (22 of 62) | 41.9 % (13 of 31) | 29.0 % (9 of 31) | |
Methyl | 87.5 % (98 of 112) | 92.9 % (52 of 56) | 82.1 % (46 of 56) |
1. Faap24
MGSSHHHHHH SSHMLVPRGS SKNPLLGKKR ALLLSEPSLL RTVQQIPGVG KVKAPLLLQK FPSIQQLSNA SIGELEQVVG QAVAQQIHAF FTQPRSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24 | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | PMSF | natural abundance | 0.2 mM | |
5 | D2O | natural abundance | 7 % | |
6 | H2O | natural abundance | 93 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18725_2lyh.nef |
Input source #2: Coordindates | 2lyh.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--120-----130-------140-------150-------160-------170-------180-------190-------200-------210----- MGSSHHHHHHSSHMLVPRGSLEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSHMLVPRGSLEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR --------10--------20--------30--------40--------50--------60--------70--------80--------90--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 98 | 0 | 0 | 100.0 |
Content subtype: combined_18725_2lyh.nef
Assigned chemical shifts
--120-----130-------140-------150-------160-------170-------180-------190-------200-------210----- MGSSHHHHHHSSHMLVPRGSLEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR |||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ............HMLVPRGS...SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 609 | 454 | 74.5 |
13C chemical shifts | 448 | 341 | 76.1 |
15N chemical shifts | 106 | 79 | 74.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 195 | 162 | 83.1 |
13C chemical shifts | 196 | 165 | 84.2 |
15N chemical shifts | 90 | 75 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 414 | 292 | 70.5 |
13C chemical shifts | 252 | 176 | 69.8 |
15N chemical shifts | 16 | 4 | 25.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 53 | 88.3 |
13C chemical shifts | 60 | 47 | 78.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 13 | 41.9 |
13C chemical shifts | 31 | 9 | 29.0 |
Distance restraints
--120-----130-------140-------150-------160-------170-------180-------190-------200-------210----- MGSSHHHHHHSSHMLVPRGSLEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR ||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ................PRGSL....NPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Dihedral angle restraints
--120-----130-------140-------150-------160-------170-------180-------190-------200-------210----- MGSSHHHHHHSSHMLVPRGSLEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR |||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| ...............VPRGSLEPSKNPLLGKKRALLLSEPSLLRTVQQIPG.GKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR