1H, 13C, 15N backbone NMR resonance assignments for N-terminal RNA recognition motif of HvRBP1 from Hordeum vulgare L. (barley)
MAESDGAEYR CFVGSLSWNT DDRGLEAAFS SFGEILDAKI INDRETGRSR GFGFVSFSNE QAMQDAIEGM NGKELDGRSI VVNEAQSRGY GG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 76.0 % (760 of 1000) | 78.2 % (405 of 518) | 68.8 % (262 of 381) | 92.1 % (93 of 101) |
Backbone | 84.6 % (467 of 552) | 97.5 % (192 of 197) | 69.6 % (183 of 263) | 100.0 % (92 of 92) |
Sidechain | 70.6 % (372 of 527) | 66.4 % (213 of 321) | 80.2 % (158 of 197) | 11.1 % (1 of 9) |
Aromatic | 18.2 % (16 of 88) | 18.2 % (8 of 44) | 18.6 % (8 of 43) | 0.0 % (0 of 1) |
Methyl | 87.5 % (63 of 72) | 80.6 % (29 of 36) | 94.4 % (34 of 36) |
1. RBP1
MAESDGAEYR CFVGSLSWNT DDRGLEAAFS SFGEILDAKI INDRETGRSR GFGFVSFSNE QAMQDAIEGM NGKELDGRSI VVNEAQSRGY GGSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
15C | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.1013291 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13N | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
15C | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.1013291 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13N | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
15C | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.1013291 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13N | DSS | methyl carbons | 0.0 ppm | external | indirect | 0.2514495 |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBP1 | [U-99% 13C; U-99% 15N] | 15 mM | |
2 | sodium azide | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | D2O | natural abundance | 5 % | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium chloride | natural abundance | 500 mM | |
7 | PMSF | natural abundance | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18776_2mpu.nef |
Input source #2: Coordindates | 2mpu.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAKIINDRETGRSRGFGFVSFSNEQAMQDAIEGMNGKELDGRSIVVNEAQSRGYGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAKIINDRETGRSRGFGFVSFSNEQAMQDAIEGMNGKELDGRSIVVNEAQSRGYGG
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 92 | 0 | 0 | 100.0 |
Content subtype: combined_18776_2mpu.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAKIINDRETGRSRGFGFVSFSNEQAMQDAIEGMNGKELDGRSIVVNEAQSRGYGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAKIINDRETGRSRGFGFVSFSNEQAMQDAIEGMNGKELDGRSIVVNEAQSRGYGG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 518 | 390 | 75.3 |
13C chemical shifts | 381 | 248 | 65.1 |
15N chemical shifts | 108 | 91 | 84.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 197 | 189 | 95.9 |
13C chemical shifts | 184 | 92 | 50.0 |
15N chemical shifts | 92 | 91 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 321 | 201 | 62.6 |
13C chemical shifts | 197 | 156 | 79.2 |
15N chemical shifts | 16 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 26 | 66.7 |
13C chemical shifts | 39 | 34 | 87.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 8 | 18.2 |
13C chemical shifts | 43 | 8 | 18.6 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAKIINDRETGRSRGFGFVSFSNEQAMQDAIEGMNGKELDGRSIVVNEAQSRGYGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAKIINDRETGRSRGFGFVSFSNEQAMQDAIEGMNGKELDGRSIVVNEAQSRGYGG
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAKIINDRETGRSRGFGFVSFSNEQAMQDAIEGMNGKELDGRSIVVNEAQSRGYGG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAESDGAEYRCFVGSLSWNTDDRGLEAAFSSFGEILDAKIINDRETGRSRGFGFVSFSNEQAMQDAIEGMNGKELDGRSIVVNEAQSRG --------10--------20--------30--------40--------50--------60--------70--------80---------