ubiquitin-like domain-containing C-terminal domain phosphatase (UBLCP1)
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.9 % (826 of 973) | 91.4 % (467 of 511) | 73.9 % (280 of 379) | 95.2 % (79 of 83) |
Backbone | 85.6 % (409 of 478) | 97.0 % (160 of 165) | 72.9 % (172 of 236) | 100.0 % (77 of 77) |
Sidechain | 86.3 % (491 of 569) | 88.7 % (307 of 346) | 83.9 % (182 of 217) | 33.3 % (2 of 6) |
Aromatic | 26.7 % (8 of 30) | 46.7 % (7 of 15) | 0.0 % (0 of 14) | 100.0 % (1 of 1) |
Methyl | 93.5 % (101 of 108) | 92.6 % (50 of 54) | 94.4 % (51 of 54) |
1. entity 1
MALPIIVKWG GQEYSVTTLS EDDTVLDLKQ FLKTLTGVLP ERQKLLGLKV KGKPAENDVK LGALKLKPNT KIMMMGTREE SXSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-15N] | 0.6 mM | |
2 | entity_1 | [U-13C; U-15N] | 0.6 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-15N] | 0.6 mM | |
2 | entity_1 | [U-13C; U-15N] | 0.6 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-15N] | 0.6 mM | |
2 | entity_1 | [U-13C; U-15N] | 0.6 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-15N] | 0.6 mM | |
2 | entity_1 | [U-13C; U-15N] | 0.6 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-15N] | 0.6 mM | |
2 | entity_1 | [U-13C; U-15N] | 0.6 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-15N] | 0.6 mM | |
2 | entity_1 | [U-13C; U-15N] | 0.6 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-15N] | 0.6 mM | |
2 | entity_1 | [U-13C; U-15N] | 0.6 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-15N] | 0.6 mM | |
2 | entity_1 | [U-13C; U-15N] | 0.6 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-15N] | 0.6 mM | |
2 | entity_1 | [U-13C; U-15N] | 0.6 mM |
Bruker DRX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-15N] | 0.6 mM | |
2 | entity_1 | [U-13C; U-15N] | 0.6 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18844_2m17.nef |
Input source #2: Coordindates | 2m17.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:81:SER:C | 1:82:NH2:N | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
A | 90 | NH2 | AMINO GROUP | Coordinates |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------8090 MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESX |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESX --------10--------20--------30--------40--------50--------60--------70--------80--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 82 | 0 | 0 | 100.0 |
Content subtype: combined_18844_2m17.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------8090 MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESX |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREE --------10--------20--------30--------40--------50--------60--------70--------80
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 513 | 462 | 90.1 |
13C chemical shifts | 379 | 258 | 68.1 |
15N chemical shifts | 86 | 77 | 89.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 165 | 162 | 98.2 |
13C chemical shifts | 162 | 80 | 49.4 |
15N chemical shifts | 78 | 76 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 348 | 300 | 86.2 |
13C chemical shifts | 217 | 178 | 82.0 |
15N chemical shifts | 8 | 1 | 12.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 51 | 87.9 |
13C chemical shifts | 58 | 51 | 87.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 15 | 7 | 46.7 |
13C chemical shifts | 14 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------8090 MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESX |||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLL.LKVKGKPAENDVKLGALKLKPNTKIMMMGTREE --------10--------20--------30--------40--------50--------60--------70--------80
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------8090 MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESX |||||||||||||||| |||| ||||||||||||||||||||||| ||||||| |||||||||||||||||||||| MALPIIVKWGGQEYSV..LSED.TVLDLKQFLKTLTGVLPERQKLL.LKVKGKP...DVKLGALKLKPNTKIMMMGTRE --------10--------20--------30--------40--------50--------60--------70---------