Solution structure of the Haloferax volcanii HVO_2177 protein
GGGRDYKDDD DKGTMELELR FFATFREVVG QKSIYWRVDD DATVGDVLRS LEAEYDGLAG RLIEDGEVKP HVNVLKNGRE VVHLDGMATA LDDGDAVSVF PPVAGG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.8 % (1085 of 1157) | 91.9 % (546 of 594) | 96.3 % (439 of 456) | 93.5 % (100 of 107) |
Backbone | 93.7 % (590 of 630) | 92.4 % (206 of 223) | 94.4 % (287 of 304) | 94.2 % (97 of 103) |
Sidechain | 93.1 % (576 of 619) | 90.3 % (335 of 371) | 97.5 % (238 of 244) | 75.0 % (3 of 4) |
Aromatic | 100.0 % (84 of 84) | 100.0 % (42 of 42) | 100.0 % (41 of 41) | 100.0 % (1 of 1) |
Methyl | 97.5 % (117 of 120) | 95.0 % (57 of 60) | 100.0 % (60 of 60) |
1. Ubl protein HVO 2177
GGGRDYKDDD DKGTMELELR FFATFREVVG QKSIYWRVDD DATVGDVLRS LEAEYDGLAG RLIEDGEVKP HVNVLKNGRE VVHLDGMATA LDDGDAVSVF PPVAGGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaCl | natural abundance | 500 mM | |
3 | Na-K phosphate | natural abundance | 25 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | NaN3 | natural abundance | 0.02 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
7 | NaCl | natural abundance | 500 mM | |
8 | Na-K phosphate | natural abundance | 25 mM | |
9 | EDTA | natural abundance | 0.2 mM | |
10 | NaN3 | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.772 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.772 ppm | internal | direct | 1.0 |
15N | water | protons | 4.772 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.772 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.772 ppm | internal | direct | 1.0 |
15N | water | protons | 4.772 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.772 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.772 ppm | internal | direct | 1.0 |
15N | water | protons | 4.772 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.772 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.772 ppm | internal | direct | 1.0 |
15N | water | protons | 4.772 ppm | na | indirect | 0.1013291 |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaCl | natural abundance | 500 mM | |
3 | Na-K phosphate | natural abundance | 25 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
7 | NaCl | natural abundance | 500 mM | |
8 | Na-K phosphate | natural abundance | 25 mM | |
9 | EDTA | natural abundance | 0.2 mM | |
10 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaCl | natural abundance | 500 mM | |
3 | Na-K phosphate | natural abundance | 25 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaCl | natural abundance | 500 mM | |
3 | Na-K phosphate | natural abundance | 25 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaCl | natural abundance | 500 mM | |
3 | Na-K phosphate | natural abundance | 25 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaCl | natural abundance | 500 mM | |
3 | Na-K phosphate | natural abundance | 25 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaCl | natural abundance | 500 mM | |
3 | Na-K phosphate | natural abundance | 25 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaCl | natural abundance | 500 mM | |
3 | Na-K phosphate | natural abundance | 25 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
7 | NaCl | natural abundance | 500 mM | |
8 | Na-K phosphate | natural abundance | 25 mM | |
9 | EDTA | natural abundance | 0.2 mM | |
10 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
7 | NaCl | natural abundance | 500 mM | |
8 | Na-K phosphate | natural abundance | 25 mM | |
9 | EDTA | natural abundance | 0.2 mM | |
10 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
7 | NaCl | natural abundance | 500 mM | |
8 | Na-K phosphate | natural abundance | 25 mM | |
9 | EDTA | natural abundance | 0.2 mM | |
10 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | NaCl | natural abundance | 500 mM | |
3 | Na-K phosphate | natural abundance | 25 mM | |
4 | EDTA | natural abundance | 0.2 mM | |
5 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
7 | NaCl | natural abundance | 500 mM | |
8 | Na-K phosphate | natural abundance | 25 mM | |
9 | EDTA | natural abundance | 0.2 mM | |
10 | NaN3 | natural abundance | 0.02 % |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Ubl protein HVO_2177 | [U-99% 13C; U-99% 15N] | 1 mM | |
7 | NaCl | natural abundance | 500 mM | |
8 | Na-K phosphate | natural abundance | 25 mM | |
9 | EDTA | natural abundance | 0.2 mM | |
10 | NaN3 | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18850_2m19.nef |
Input source #2: Coordindates | 2m19.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----------------------10--------20--------30--------40--------50--------60--------70--------80------ GGGRDYKDDDDKGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GGGRDYKDDDDKGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVF --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --90-- PPVAGG |||||| PPVAGG ------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_18850_2m19.nef
Assigned chemical shifts
----------------------10--------20--------30--------40--------50--------60--------70--------80------ GGGRDYKDDDDKGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVF |||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..GRDYKD..DKGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVF --90-- PPVAGG |||||| PPVAGG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 594 | 554 | 93.3 |
13C chemical shifts | 456 | 441 | 96.7 |
15N chemical shifts | 114 | 98 | 86.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 223 | 207 | 92.8 |
13C chemical shifts | 212 | 200 | 94.3 |
15N chemical shifts | 103 | 95 | 92.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 371 | 347 | 93.5 |
13C chemical shifts | 244 | 241 | 98.8 |
15N chemical shifts | 11 | 3 | 27.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 62 | 100.0 |
13C chemical shifts | 62 | 62 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 42 | 100.0 |
13C chemical shifts | 41 | 41 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
----------------------10--------20--------30--------40--------50--------60--------70--------80------ GGGRDYKDDDDKGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVF |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...RDYK....KGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVF ----------------------10--------20--------30--------40--------50--------60--------70--------80------ --90-- PPVAGG ||||| PPVAG --90-
Dihedral angle restraints
----------------------10--------20--------30--------40--------50--------60--------70--------80------ GGGRDYKDDDDKGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........KGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVF ----------------------10--------20--------30--------40--------50--------60--------70--------80------ --90-- PPVAGG ||| PPV ---