Solution structure of a chaperone in type III secretion system
MSIVSQTRNK ELLLKKIDSL IEAIKKIIAE FDVVKESVNE LSEKAKTDPQ AAEKLNKLIE GYTYGEERKL YDSALSKIEK LIETLSPARS KSQSTMNQRN RNNRKIV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 27.0 % (351 of 1301) | 11.0 % (76 of 690) | 42.8 % (212 of 495) | 54.3 % (63 of 116) |
Backbone | 53.1 % (339 of 638) | 31.3 % (67 of 214) | 65.5 % (209 of 319) | 60.0 % (63 of 105) |
Sidechain | 11.2 % (86 of 768) | 1.9 % (9 of 476) | 27.4 % (77 of 281) | 0.0 % (0 of 11) |
Aromatic | 0.0 % (0 of 34) | 0.0 % (0 of 17) | 0.0 % (0 of 17) | |
Methyl | 10.2 % (13 of 128) | 6.3 % (4 of 64) | 14.1 % (9 of 64) |
1. CesAB
MSIVSQTRNK ELLLKKIDSL IEAIKKIIAE FDVVKESVNE LSEKAKTDPQ AAEKLNKLIE GYTYGEERKL YDSALSKIEK LIETLSPARS KSQSTMNQRN RNNRKIVSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 321 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CesAB (Type III secretion system, chaperone for EspA and EspB) | [U-13C; U-15N; U-2H], 13CH3-Ala, Ile, Val, Leu | 500 mM | |
2 | KPi | natural abundance | 50 mM | |
3 | KCl | natural abundance | 300 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 321 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CesAB (Type III secretion system, chaperone for EspA and EspB) | [U-13C; U-15N; U-2H], 13CH3-Ala, Ile, Val, Leu | 500 mM | |
2 | KPi | natural abundance | 50 mM | |
3 | KCl | natural abundance | 300 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 321 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CesAB (Type III secretion system, chaperone for EspA and EspB) | [U-13C; U-15N; U-2H], 13CH3-Ala, Ile, Val, Leu | 500 mM | |
2 | KPi | natural abundance | 50 mM | |
3 | KCl | natural abundance | 300 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 321 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CesAB (Type III secretion system, chaperone for EspA and EspB) | [U-13C; U-15N; U-2H], 13CH3-Ala, Ile, Val, Leu | 500 mM | |
2 | KPi | natural abundance | 50 mM | |
3 | KCl | natural abundance | 300 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 321 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CesAB (Type III secretion system, chaperone for EspA and EspB) | [U-13C; U-15N; U-2H], 13CH3-Ala, Ile, Val, Leu | 500 mM | |
2 | KPi | natural abundance | 50 mM | |
3 | KCl | natural abundance | 300 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 321 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CesAB (Type III secretion system, chaperone for EspA and EspB) | [U-13C; U-15N; U-2H], 13CH3-Ala, Ile, Val, Leu | 500 mM | |
2 | KPi | natural abundance | 50 mM | |
3 | KCl | natural abundance | 300 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 321 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CesAB (Type III secretion system, chaperone for EspA and EspB) | [U-13C; U-15N; U-2H], 13CH3-Ala, Ile, Val, Leu | 500 mM | |
2 | KPi | natural abundance | 50 mM | |
3 | KCl | natural abundance | 300 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 321 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CesAB (Type III secretion system, chaperone for EspA and EspB) | [U-13C; U-15N; U-2H], 13CH3-Ala, Ile, Val, Leu | 500 mM | |
2 | KPi | natural abundance | 50 mM | |
3 | KCl | natural abundance | 300 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 321 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CesAB (Type III secretion system, chaperone for EspA and EspB) | [U-13C; U-15N; U-2H], 13CH3-Ala, Ile, Val, Leu | 500 mM | |
2 | KPi | natural abundance | 50 mM | |
3 | KCl | natural abundance | 300 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18871_2m1n.nef |
Input source #2: Coordindates | 2m1n.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRN ------- RNNRKIV ||||||| RNNRKIV
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRN ------- RNNRKIV ||||||| RNNRKIV
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 107 | 0 | 0 | 100.0 |
B | B | 107 | 0 | 0 | 100.0 |
Content subtype: combined_18871_2m1n.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRN ||| |||||||||||||||||| |||||||||||| ||||||||||||| ||||||||||| || |||||||||||| ||| .SIV....NKELLLKKIDSLIEAIKK.IAEFDVVKESVN.LSEKAKTDPQAAE..NKLIEGYTYGE.RK..DSALSKIEKLIE...PAR........... ------- RNNRKIV ||| ....KIV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 495 | 203 | 41.0 |
1H chemical shifts | 690 | 60 | 8.7 |
15N chemical shifts | 122 | 60 | 49.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 214 | 132 | 61.7 |
1H chemical shifts | 214 | 60 | 28.0 |
15N chemical shifts | 105 | 60 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 281 | 71 | 25.3 |
1H chemical shifts | 476 | 0 | 0.0 |
15N chemical shifts | 17 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 66 | 7 | 10.6 |
1H chemical shifts | 66 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 17 | 0 | 0.0 |
1H chemical shifts | 17 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRN ||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| |||||||||||||||||||| .SIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAK..PQAAEKLNKLIEG...GEERKLYDSALSKIEKLIET --------10--------20--------30--------40--------50--------60--------70--------80---- ------- RNNRKIV
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRN ||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| |||||||||||||||||||| .SIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAK..PQAAEKLNKLIEG...GEERKLYDSALSKIEKLIET --------10--------20--------30--------40--------50--------60--------70--------80---- ------- RNNRKIV
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRN |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| .SIVS...NKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYG.ERKLYDSALSKIEKLIET --------10--------20--------30--------40--------50--------60--------70--------80---- ------- RNNRKIV
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSIVSQTRNKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRN |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| .SIVS...NKELLLKKIDSLIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYG.ERKLYDSALSKIEKLIET --------10--------20--------30--------40--------50--------60--------70--------80---- ------- RNNRKIV