Analysis of the structural and molecular basis of voltage-sensitive sodium channel inhibition by the spider toxin, Huwentoxin-IV ( -TRTX-Hh2a).
Polymer type: polypeptide(L)
Total | 1H | |
---|---|---|
All | 77.9 % (176 of 226) | 77.9 % (176 of 226) |
Backbone | 91.3 % (63 of 69) | 91.3 % (63 of 69) |
Sidechain | 72.0 % (113 of 157) | 72.0 % (113 of 157) |
Aromatic | 66.7 % (10 of 15) | 66.7 % (10 of 15) |
Methyl | 75.0 % (9 of 12) | 75.0 % (9 of 12) |
1. HWTX-IV
ECLEIFKACN PSNDQCCKSS KLVCSRKTRW CKYQISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HWTX-IV | natural abundance | 2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 150 uM | |
4 | EDTA | natural abundance | 100 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HWTX-IV | natural abundance | 2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 150 uM | |
4 | EDTA | natural abundance | 100 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HWTX-IV | natural abundance | 2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 150 uM | |
4 | EDTA | natural abundance | 100 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HWTX-IV | natural abundance | 2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 150 uM | |
4 | EDTA | natural abundance | 100 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HWTX-IV | natural abundance | 2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 150 uM | |
4 | EDTA | natural abundance | 100 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19026_2m4x.nef |
Input source #2: Coordindates | 2m4x.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:2:CYS:SG | A:17:CYS:SG | unknown | unknown | 2.03 |
A:9:CYS:SG | A:24:CYS:SG | unknown | unknown | 1.999 |
A:16:CYS:SG | A:31:CYS:SG | unknown | unknown | 2.101 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30----- ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI ||||||||||||||||||||||||||||||||||| ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 35 | 0 | 0 | 100.0 |
Content subtype: combined_19026_2m4x.nef
Assigned chemical shifts
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 226 | 176 | 77.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 63 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 157 | 113 | 72.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 12 | 9 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 15 | 10 | 66.7 |
Covalent bonds
Distance restraints
Dihedral angle restraints
--------10--------20--------30----- ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI ||||||||||||||||||||||||||||||||||| ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI