The NMR structure of the BID-BAK complex
ALPSASEEQV AQDTEEVFRS YVFYRHQQEQ EAEGVAAPAD PEMVTLPLQP SSTMGQVGRQ LAIIGDDINR RYDSEFQTML QHLQPTAENA YEYFTKIATS LFESGINWGR VVALLGFGYR LALHVYQHGL TGFLGQVTRF VVDFMLHHCI ARWIAQRGGW VAALNLGNG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.6 % (1877 of 2167) | 98.8 % (1102 of 1115) | 70.6 % (598 of 847) | 86.3 % (177 of 205) |
Backbone | 80.4 % (897 of 1116) | 99.2 % (383 of 386) | 65.1 % (357 of 548) | 86.3 % (157 of 182) |
Sidechain | 92.9 % (1136 of 1223) | 98.8 % (720 of 729) | 84.1 % (396 of 471) | 87.0 % (20 of 23) |
Aromatic | 83.8 % (176 of 210) | 98.1 % (103 of 105) | 68.6 % (70 of 102) | 100.0 % (3 of 3) |
Methyl | 92.4 % (207 of 224) | 100.0 % (112 of 112) | 84.8 % (95 of 112) |
1. human cBAK
ALPSASEEQV AQDTEEVFRS YVFYRHQQEQ EAEGVAAPAD PEMVTLPLQP SSTMGQVGRQ LAIIGDDINR RYDSEFQTML QHLQPTAENA YEYFTKIATS LFESGINWGR VVALLGFGYR LALHVYQHGL TGFLGQVTRF VVDFMLHHCI ARWIAQRGGW VAALNLGNG2. human BID BH3 SAHB
EDIIRNIARH LAXVGDXXDR SIXSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Bruker Avance - 600 MHz cryogenically cooled triple resonance z-gradient probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details ~0.5 mM SAHB-BAK 20 mM Phosphate buffer pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | human cBAK | [U-98% 13C; U-98% 15N] | 0.5 mM | |
2 | human BID BH3 SAHB | natural abundance | 0.5 mM | |
3 | Phosphate buffer | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19045_2m5b.nef |
Input source #2: Coordindates | 2m5b.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
2:12:ALA:C | 2:13:MK8:N | unknown | unknown | n/a |
2:13:MK8:C | 2:14:VAL:N | unknown | unknown | n/a |
2:16:ASP:C | 2:17:MK8:N | unknown | unknown | n/a |
2:17:MK8:C | 2:18:NLE:N | unknown | unknown | n/a |
2:18:NLE:C | 2:19:ASP:N | unknown | unknown | n/a |
2:22:ILE:C | 2:23:NH2:N | unknown | unknown | n/a |
2:13:MK8:CE | 2:17:MK8:CE | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 92 | MK8 | 2-methyl-L-norleucine | Assigned chemical shifts, Coordinates |
B | 96 | MK8 | 2-methyl-L-norleucine | Assigned chemical shifts, Coordinates |
B | 97 | NLE | NORLEUCINE | Assigned chemical shifts, Distance restraints, Coordinates |
B | 102 | NH2 | AMINO GROUP | Torsion angle restraints, Coordinates |
Sequence alignments
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- ALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 120-------130-------140-------150-------160-------170-------180------ LFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG -------110-------120-------130-------140-------150-------160---------
80-------90-------100-- EDIIRNIARHLAXVGDXXDRSIX ||||||||||||||||||||||| EDIIRNIARHLAXVGDXXDRSIX --------10--------20---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 169 | 0 | 0 | 100.0 |
B | B | 23 | 0 | 0 | 100.0 |
Content subtype: combined_19045_2m5b.nef
Assigned chemical shifts
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- ALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATS 120-------130-------140-------150-------160-------170-------180------ LFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG
80-------90-------100-- EDIIRNIARHLAXVGDXXDRSIX |||||||||||||||||||||| EDIIRNIARHLAXVGDXXDRSI 80-------90-------100-
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1005 | 995 | 99.0 |
13C chemical shifts | 765 | 556 | 72.7 |
15N chemical shifts | 195 | 176 | 90.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 347 | 344 | 99.1 |
13C chemical shifts | 338 | 168 | 49.7 |
15N chemical shifts | 163 | 155 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 658 | 651 | 98.9 |
13C chemical shifts | 427 | 388 | 90.9 |
15N chemical shifts | 32 | 21 | 65.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 102 | 102 | 100.0 |
13C chemical shifts | 102 | 95 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 103 | 103 | 100.0 |
13C chemical shifts | 100 | 68 | 68.0 |
15N chemical shifts | 3 | 3 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 139 | 122 | 87.8 |
13C chemical shifts | 97 | 0 | 0.0 |
15N chemical shifts | 26 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 40 | 97.6 |
13C chemical shifts | 39 | 0 | 0.0 |
15N chemical shifts | 20 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 98 | 82 | 83.7 |
13C chemical shifts | 44 | 0 | 0.0 |
15N chemical shifts | 4 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 19 | 17 | 89.5 |
13C chemical shifts | 19 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 2 | 0 | 0.0 |
13C chemical shifts | 2 | 0 | 0.0 |
Covalent bonds
Distance restraints
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- ALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATS ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADP.MVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATS 120-------130-------140-------150-------160-------170-------180------ LFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG ||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||| LFESGINWGRVVALLGFGYRLALHVYQHGLT.FLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG
80-------90-------100-- EDIIRNIARHLAXVGDXXDRSIX |||||||||||| ||| ||||| EDIIRNIARHLA.VGD.XDRSI 80-------90-------100-
80-------90-------100-- EDIIRNIARHLAXVGDXXDRSIX || || || || ||||| ..II..IA..LA.VG..XDRSI 80-------90-------100-
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- ALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATS || ||||||||||||||||||| || |||||||||||||| || || ||| |||||||| .....SE.QVAQDTEEVFRSYVFYRHQ.............................VG.QLAIIGDDINRRYD..FQ..LQ.......NAY.YFTKIATS --20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- 120-------130-------140-------150-------160-------170-------180------ LFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG || | |||||||||||||||| | |||||||||||||| |||||||| LF....N.GRVVALLGFGYRLALH.Y......FLGQVTRFVVDFML...IARWIAQR 120-------130-------140-------150-------160-------170----
Dihedral angle restraints
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- ALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATS ||| |||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||||||||||||||||| |||||||||||||||| ALP..SEEQVAQDTEEVFRSYVFYRHQQEQEAE..AAP...EMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL.PTAENAYEYFTKIATS 120-------130-------140-------150-------160-------170-------180------ LFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG |||| |||||||||||||| ||||| || |||||||||||| ||||||||||||||||||||| LFES....GRVVALLGFGYRLA..VYQHG..GF.GQVTRFVVDFML..CIARWIAQRGGWVAALNLGNG
80-------90-------100-- EDIIRNIARHLAXVGDXXDRSIX |||||||||| || ||||| .DIIRNIARHL..VG...DRSIX