Solution structure of the a C-terminal domain of translation initiation factor IF-3 from Campylobacter jejuni
MSLKVIDIKE IKLSVKIAQN DINYKVKHAL EFLEQGKHVR FRVFLKGREM ATPEAGVALL EKIWTMIENE ANRDKEPNFE GRYVNMLVTP KKAEGHHHHH H
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.7 % (1130 of 1246) | 90.2 % (591 of 655) | 91.3 % (442 of 484) | 90.7 % (97 of 107) |
Backbone | 91.5 % (549 of 600) | 90.2 % (184 of 204) | 93.0 % (277 of 298) | 89.8 % (88 of 98) |
Sidechain | 90.4 % (671 of 742) | 90.2 % (407 of 451) | 90.4 % (255 of 282) | 100.0 % (9 of 9) |
Aromatic | 72.0 % (72 of 100) | 72.0 % (36 of 50) | 71.4 % (35 of 49) | 100.0 % (1 of 1) |
Methyl | 95.5 % (107 of 112) | 94.6 % (53 of 56) | 96.4 % (54 of 56) |
1. IF-3
MSLKVIDIKE IKLSVKIAQN DINYKVKHAL EFLEQGKHVR FRVFLKGREM ATPEAGVALL EKIWTMIENE ANRDKEPNFE GRYVNMLVTP KKAEGHHHHH HSolvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 0.1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na phosphate buffer | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate pH6.8, 50mM NaCl, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | D2O | natural abundance | 100 % | |
9 | Na phosphate buffer | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 50 mM | |
11 | EDTA | natural abundance | 0.1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 0.1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na phosphate buffer | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 0.1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na phosphate buffer | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate pH6.8, 50mM NaCl, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | D2O | natural abundance | 100 % | |
9 | Na phosphate buffer | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 50 mM | |
11 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate pH6.8, 50mM NaCl, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | D2O | natural abundance | 100 % | |
9 | Na phosphate buffer | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 50 mM | |
11 | EDTA | natural abundance | 0.1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate pH6.8, 50mM NaCl, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | D2O | natural abundance | 100 % | |
9 | Na phosphate buffer | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 50 mM | |
11 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate pH6.8, 50mM NaCl, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | D2O | natural abundance | 100 % | |
9 | Na phosphate buffer | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 50 mM | |
11 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 0.1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na phosphate buffer | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 0.1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na phosphate buffer | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 0.1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na phosphate buffer | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 0.1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na phosphate buffer | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 0.1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na phosphate buffer | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 20mM Na phosphate buffer, 50mM NaCl, pH 6.8, 0.1 mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF-3 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Na phosphate buffer | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 50 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19168_2m71.nef |
Input source #2: Coordindates | 2m71.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYVNMLVTPKKAEGHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLKVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYVNMLVTPKKAEGHHHHH - H | H
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 101 | 0 | 0 | 100.0 |
Content subtype: combined_19168_2m71.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYVNMLVTPKKAEGHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...KVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYVNMLVTPKKAEG --------10--------20--------30--------40--------50--------60--------70--------80--------90----- - H
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 655 | 589 | 89.9 |
13C chemical shifts | 484 | 433 | 89.5 |
15N chemical shifts | 112 | 95 | 84.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 204 | 181 | 88.7 |
13C chemical shifts | 202 | 181 | 89.6 |
15N chemical shifts | 98 | 84 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 451 | 408 | 90.5 |
13C chemical shifts | 282 | 252 | 89.4 |
15N chemical shifts | 14 | 11 | 78.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 57 | 95.0 |
13C chemical shifts | 60 | 57 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 36 | 72.0 |
13C chemical shifts | 49 | 35 | 71.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYVNMLVTPKKAEGHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...KVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYVNMLVTPKKAEG --------10--------20--------30--------40--------50--------60--------70--------80--------90----- - H
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYVNMLVTPKKAEGHHHHH |||||| |||||||||||||| || || | ||||| || |||| || || ||| || | | | | ||| |||||| .....IDIKEI..SVKIAQNDINYKVK.AL..LE..K.VRFRV.LK...MATP.AG..LL.KIW.MI...A.R...P.F..RYV.MLVTPK --------10--------20--------30--------40--------50--------60--------70--------80--------90- - H
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLKVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYVNMLVTPKKAEGHHHHH ||||||||||| ||||||||||||||||||| ||||||||| |||||||||||||||||||||| |||||||||||||| ....VIDIKEIKLSV.IAQNDINYKVKHALEFLEQ.KHVRFRVFL.......PEAGVALLEKIWTMIENEANRD.EPNFEGRYVNMLVT --------10--------20--------30--------40--------50--------60--------70--------80--------- - H