1H, 13C, 15N assignments for P. yoelii Merozoite Surface Protein 1
GVDPKHVCVD TRDIPKNAGC FRDDDGTEEW RCLLGYKKGE GNTCVENNNP TCDINNGGCD PTASCQNAES TENSKKIICT CKEPTPNAYY EGVFCSSSS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.4 % (1029 of 1057) | 98.4 % (542 of 551) | 95.3 % (382 of 401) | 100.0 % (105 of 105) |
Backbone | 98.1 % (571 of 582) | 99.0 % (199 of 201) | 96.9 % (279 of 288) | 100.0 % (93 of 93) |
Sidechain | 97.0 % (548 of 565) | 98.0 % (343 of 350) | 95.1 % (193 of 203) | 100.0 % (12 of 12) |
Aromatic | 76.7 % (46 of 60) | 86.7 % (26 of 30) | 65.5 % (19 of 29) | 100.0 % (1 of 1) |
Methyl | 100.0 % (68 of 68) | 100.0 % (34 of 34) | 100.0 % (34 of 34) |
1. MSP1
GVDPKHVCVD TRDIPKNAGC FRDDDGTEEW RCLLGYKKGE GNTCVENNNP TCDINNGGCD PTASCQNAES TENSKKIICT CKEPTPNAYY EGVFCSSSSSolvent system 95% H2O/5% D2O, Temperature 273 K, Details 1mM 13C/15N pYoelii MSP1 25mM KPi 50mM Kcl ph6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSP1 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium chloride | natural abundance | 50.0 mM | |
3 | potassium phosphate | natural abundance | 25.0 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.771 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.771 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.771 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.771 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, Details 1mM 13C/15N pYoelii MSP1 25mM KPi 50mM Kcl ph6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSP1 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium chloride | natural abundance | 50.0 mM | |
3 | potassium phosphate | natural abundance | 25.0 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, Details 1mM 13C/15N pYoelii MSP1 25mM KPi 50mM Kcl ph6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSP1 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium chloride | natural abundance | 50.0 mM | |
3 | potassium phosphate | natural abundance | 25.0 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, Details 1mM 13C/15N pYoelii MSP1 25mM KPi 50mM Kcl ph6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSP1 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium chloride | natural abundance | 50.0 mM | |
3 | potassium phosphate | natural abundance | 25.0 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, Details 1mM 13C/15N pYoelii MSP1 25mM KPi 50mM Kcl ph6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSP1 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium chloride | natural abundance | 50.0 mM | |
3 | potassium phosphate | natural abundance | 25.0 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, Details 1mM 13C/15N pYoelii MSP1 25mM KPi 50mM Kcl ph6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSP1 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium chloride | natural abundance | 50.0 mM | |
3 | potassium phosphate | natural abundance | 25.0 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, Details 1mM 13C/15N pYoelii MSP1 25mM KPi 50mM Kcl ph6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSP1 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium chloride | natural abundance | 50.0 mM | |
3 | potassium phosphate | natural abundance | 25.0 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, Details 1mM 13C/15N pYoelii MSP1 25mM KPi 50mM Kcl ph6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSP1 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium chloride | natural abundance | 50.0 mM | |
3 | potassium phosphate | natural abundance | 25.0 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, Details 1mM 13C/15N pYoelii MSP1 25mM KPi 50mM Kcl ph6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSP1 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium chloride | natural abundance | 50.0 mM | |
3 | potassium phosphate | natural abundance | 25.0 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, Details 1mM 13C/15N pYoelii MSP1 25mM KPi 50mM Kcl ph6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSP1 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | potassium chloride | natural abundance | 50.0 mM | |
3 | potassium phosphate | natural abundance | 25.0 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19233_2mgp.nef |
Input source #2: Coordindates | 2mgp.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:8:CYS:SG | A:20:CYS:SG | oxidized, CA 56.55, CB 41.75 ppm | oxidized, CA 55.675, CB 41.317 ppm | 2.037 |
A:32:CYS:SG | A:44:CYS:SG | oxidized, CA 54.261, CB 36.372 ppm | oxidized, CA 54.753, CB 42.023 ppm | 2.023 |
A:52:CYS:SG | A:65:CYS:SG | oxidized, CA 55.998, CB 36.852 ppm | oxidized, CA 55.814, CB 37.995 ppm | 2.034 |
A:59:CYS:SG | A:79:CYS:SG | oxidized, CA 52.856, CB 37.201 ppm | oxidized, CA 52.048, CB 39.167 ppm | 2.026 |
A:81:CYS:SG | A:95:CYS:SG | oxidized, CA 55.78, CB 37.42 ppm | oxidized, CA 52.555, CB 40.953 ppm | 2.042 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- GVDPKHVCVDTRDIPKNAGCFRDDDGTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GVDPKHVCVDTRDIPKNAGCFRDDDGTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 99 | 0 | 0 | 100.0 |
Content subtype: combined_19233_2mgp.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- GVDPKHVCVDTRDIPKNAGCFRDDDGTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GVDPKHVCVDTRDIPKNAGCFRDDDGTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 551 | 549 | 99.6 |
13C chemical shifts | 401 | 382 | 95.3 |
15N chemical shifts | 108 | 108 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 201 | 200 | 99.5 |
13C chemical shifts | 198 | 189 | 95.5 |
15N chemical shifts | 93 | 93 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 350 | 349 | 99.7 |
13C chemical shifts | 203 | 193 | 95.1 |
15N chemical shifts | 15 | 15 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 34 | 100.0 |
13C chemical shifts | 34 | 34 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 30 | 100.0 |
13C chemical shifts | 29 | 19 | 65.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- GVDPKHVCVDTRDIPKNAGCFRDDDGTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GVDPKHVCVDTRDIPKNAGCFRDDDGTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSS