Structure, function, and tethering of DNA-binding domains in 54 transcriptional activators
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 69.5 % (623 of 897) | 74.6 % (358 of 480) | 59.5 % (207 of 348) | 84.1 % (58 of 69) |
Backbone | 72.6 % (302 of 416) | 82.4 % (117 of 142) | 62.1 % (128 of 206) | 83.8 % (57 of 68) |
Sidechain | 68.7 % (376 of 547) | 71.3 % (241 of 338) | 64.4 % (134 of 208) | 100.0 % (1 of 1) |
Aromatic | 53.8 % (28 of 52) | 84.6 % (22 of 26) | 23.1 % (6 of 26) | |
Methyl | 80.0 % (64 of 80) | 82.5 % (33 of 40) | 77.5 % (31 of 40) |
1. entity
TSSELPELLR KRERKTGDLP KFIEETEKKR IIEALEKTGY VKSRAAKLLG YTLRQLDYRI KKYGIELKKFSolvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Solvent system 100% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
6 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DRX - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
6 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | [U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Temperature 273 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Nlh2 | [U-100% 13C; U-100% 15N] | 1 mM | |
6 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19251_2m8g.nef |
Input source #2: Coordindates | 2m8g.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
X | X | 70 | 0 | 0 | 100.0 |
Content subtype: combined_19251_2m8g.nef
Assigned chemical shifts
--430-----440-------450-------460-------470-------480-------490------- TSSELPELLRKRERKTGDLPKFIEETEKKRIIEALEKTGYVKSRAAKLLGYTLRQLDYRIKKYGIELKKF |||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||| ..SELPELLR......GDLPKFIEETEKKRIIEALEKTGYVKSRAAKLLGYTLRQLDYRIKKYGIELKKF
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 480 | 349 | 72.7 |
13C chemical shifts | 348 | 187 | 53.7 |
15N chemical shifts | 76 | 58 | 76.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 142 | 116 | 81.7 |
13C chemical shifts | 140 | 61 | 43.6 |
15N chemical shifts | 68 | 57 | 83.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 338 | 233 | 68.9 |
13C chemical shifts | 208 | 126 | 60.6 |
15N chemical shifts | 8 | 1 | 12.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 32 | 80.0 |
13C chemical shifts | 40 | 31 | 77.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 26 | 22 | 84.6 |
13C chemical shifts | 26 | 0 | 0.0 |
Distance restraints
--430-----440-------450-------460-------470-------480-------490------- TSSELPELLRKRERKTGDLPKFIEETEKKRIIEALEKTGYVKSRAAKLLGYTLRQLDYRIKKYGIELKKF |||||| |||||||||||||||||||||||| ||||||||||||||||||||||||||| ..SELPEL.........DLPKFIEETEKKRIIEALEKTGYV..RAAKLLGYTLRQLDYRIKKYGIELKKF
Dihedral angle restraints
--430-----440-------450-------460-------470-------480-------490------- TSSELPELLRKRERKTGDLPKFIEETEKKRIIEALEKTGYVKSRAAKLLGYTLRQLDYRIKKYGIELKKF |||||||| |||||||||||||||||||| |||||||||||||||||||||||| ...ELPELLRK........PKFIEETEKKRIIEALEKTG..KSRAAKLLGYTLRQLDYRIKKYGI --430-----440-------450-------460-------470-------480-------490--