Structure of uninhibited ETV6 ETS domain
GSHMGRIADS RLLWDYVYQL LSDSRYENFI RWEDKESKIF RIVDPNGLAR LWGNHKNRTN MTYEKMSRAL RHYYKLNIIR KEPGQRLLFR FMKTPDEIMS GR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.3 % (1098 of 1287) | 92.2 % (630 of 683) | 74.3 % (367 of 494) | 91.8 % (101 of 110) |
Backbone | 81.4 % (493 of 606) | 92.8 % (192 of 207) | 69.7 % (209 of 300) | 92.9 % (92 of 99) |
Sidechain | 90.0 % (699 of 777) | 92.0 % (438 of 476) | 86.9 % (252 of 290) | 81.8 % (9 of 11) |
Aromatic | 83.1 % (113 of 136) | 86.8 % (59 of 68) | 78.5 % (51 of 65) | 100.0 % (3 of 3) |
Methyl | 100.0 % (88 of 88) | 100.0 % (44 of 44) | 100.0 % (44 of 44) |
1. u ETV6 ETS
GSHMGRIADS RLLWDYVYQL LSDSRYENFI RWEDKESKIF RIVDPNGLAR LWGNHKNRTN MTYEKMSRAL RHYYKLNIIR KEPGQRLLFR FMKTPDEIMS GRSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | uninhibited ETV6 ETS domain | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | sodium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19474_2md5.nef |
Input source #2: Coordindates | 2md5.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---330-------340-------350-------360-------370-------380-------390-------400-------410-------420---- GSHMGRIADSRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMGRIADSRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -- GR || GR --
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 102 | 0 | 0 | 100.0 |
Content subtype: combined_19474_2md5.nef
Assigned chemical shifts
---330-------340-------350-------360-------370-------380-------390-------400-------410-------420---- GSHMGRIADSRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS | |||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| G.HMGRIADS.LLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS -- GR || GR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 683 | 631 | 92.4 |
13C chemical shifts | 494 | 349 | 70.6 |
15N chemical shifts | 123 | 101 | 82.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 207 | 193 | 93.2 |
13C chemical shifts | 204 | 99 | 48.5 |
15N chemical shifts | 99 | 92 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 476 | 438 | 92.0 |
13C chemical shifts | 290 | 250 | 86.2 |
15N chemical shifts | 24 | 9 | 37.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 48 | 98.0 |
13C chemical shifts | 49 | 48 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 59 | 86.8 |
13C chemical shifts | 65 | 50 | 76.9 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
---330-------340-------350-------360-------370-------380-------390-------400-------410-------420---- GSHMGRIADSRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS |||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HMGRIADS.LLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS -- GR || GR
Dihedral angle restraints
---330-------340-------350-------360-------370-------380-------390-------400-------410-------420---- GSHMGRIADSRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........RLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS ---330-------340-------350-------360-------370-------380-------390-------400-------410-------420---- -- GR | G -