Solution structure of a EF-hand domain from sea urchin polycystin-2
GGLVPRGSHM ASKRDKIADI QEALAHADAN ADQHLDFDEW RQELKCRGHA DADIEAVFAK YDVDGDRVLD AEEQMKMAHD LEGQKSDLNN QLAELE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.6 % (998 of 1066) | 91.2 % (506 of 555) | 95.6 % (388 of 406) | 99.0 % (104 of 105) |
Backbone | 97.9 % (562 of 574) | 95.9 % (189 of 197) | 98.9 % (279 of 282) | 98.9 % (94 of 95) |
Sidechain | 90.4 % (526 of 582) | 88.5 % (317 of 358) | 93.0 % (199 of 214) | 100.0 % (10 of 10) |
Aromatic | 70.0 % (42 of 60) | 76.7 % (23 of 30) | 62.1 % (18 of 29) | 100.0 % (1 of 1) |
Methyl | 100.0 % (92 of 92) | 100.0 % (46 of 46) | 100.0 % (46 of 46) |
1. entity
GGLVPRGSHM ASKRDKIADI QEALAHADAN ADQHLDFDEW RQELKCRGHA DADIEAVFAK YDVDGDRVLD AEEQMKMAHD LEGQKSDLNN QLAELESolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.38
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.7 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | calcium chloride | natural abundance | 20 mM | |
5 | TCEP | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | .05 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_19633_2mhh.nef |
Input source #2: Coordindates | 2mhh.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------20--------30--------40--------50--------60--------70--------80--------90-------100------- GGLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GGLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE --------10--------20--------30--------40--------50--------60--------70--------80--------90------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 96 | 0 | 0 | 100.0 |
Content subtype: combined_19633_2mhh.nef
Assigned chemical shifts
-------20--------30--------40--------50--------60--------70--------80--------90-------100------- GGLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 555 | 504 | 90.8 |
13C chemical shifts | 406 | 386 | 95.1 |
15N chemical shifts | 110 | 104 | 94.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 197 | 192 | 97.5 |
13C chemical shifts | 192 | 189 | 98.4 |
15N chemical shifts | 95 | 94 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 358 | 312 | 87.2 |
13C chemical shifts | 214 | 197 | 92.1 |
15N chemical shifts | 15 | 10 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 46 | 93.9 |
13C chemical shifts | 49 | 46 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 23 | 76.7 |
13C chemical shifts | 29 | 16 | 55.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-------20--------30--------40--------50--------60--------70--------80--------90-------100------- GGLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE
Dihedral angle restraints
-------20--------30--------40--------50--------60--------70--------80--------90-------100------- GGLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........HMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQL -------20--------30--------40--------50--------60--------70--------80--------90-------100---
RDC restraints
-------20--------30--------40--------50--------60--------70--------80--------90-------100------- GGLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE ||| ||||||||||||||||||||||||||||||||| |||||||||||||||| |||| ||||| ||||||| ||||||||| ..........ASK....ADIQEALAHADANADQHLDFDEWRQELKCRGHA.ADIEAVFAKYDVDGDR.LDAE.QMKMA.DLEGQKS.LNNQLAELE