NMR structure of the first RRM domain of the protein RBM39 from homo sapiens
GHMNLTPEER DARTVFCMQL AARIRPRDLE EFFSTVGKVR DVRMISDRNS RRSKGIAYVE FVDVSSVPLA IGLTGQRVLG VPIIVQASQA EKNRRRSKGI AYVEFVDVSS VPLAIGLTGQ RVLGVPIIVQ ASQAEKNRVP IIVQASQAEK NR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 59.6 % (1047 of 1756) | 58.5 % (537 of 918) | 60.1 % (408 of 679) | 64.2 % (102 of 159) |
Backbone | 63.4 % (569 of 898) | 63.8 % (196 of 307) | 62.6 % (279 of 446) | 64.8 % (94 of 145) |
Sidechain | 57.2 % (572 of 1000) | 55.8 % (341 of 611) | 59.5 % (223 of 375) | 57.1 % (8 of 14) |
Aromatic | 67.1 % (47 of 70) | 71.4 % (25 of 35) | 62.9 % (22 of 35) | |
Methyl | 59.0 % (118 of 200) | 60.0 % (60 of 100) | 58.0 % (58 of 100) |
1. entity
GHMNLTPEER DARTVFCMQL AARIRPRDLE EFFSTVGKVR DVRMISDRNS RRSKGIAYVE FVDVSSVPLA IGLTGQRVLG VPIIVQASQA EKNRRRSKGI AYVEFVDVSS VPLAIGLTGQ RVLGVPIIVQ ASQAEKNRVP IIVQASQAEK NRSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 0.6 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19642_2mhn.nef |
Input source #2: Coordindates | 2mhn.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- GHMNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 94 | 0 | 0 | 100.0 |
Content subtype: combined_19642_2mhn.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- GHMNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 569 | 523 | 91.9 |
13C chemical shifts | 421 | 385 | 91.4 |
15N chemical shifts | 109 | 95 | 87.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 190 | 187 | 98.4 |
13C chemical shifts | 188 | 169 | 89.9 |
15N chemical shifts | 90 | 87 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 379 | 336 | 88.7 |
13C chemical shifts | 233 | 216 | 92.7 |
15N chemical shifts | 19 | 8 | 42.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 60 | 100.0 |
13C chemical shifts | 60 | 58 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 26 | 25 | 96.2 |
13C chemical shifts | 26 | 22 | 84.6 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- GHMNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .HMNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNR