Zn-binding domain of eukaryotic translation initiation factor 3, subunit G
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 82.9 % (233 of 281) | 88.4 % (130 of 147) | 71.8 % (79 of 110) | 100.0 % (24 of 24) |
Backbone | 82.4 % (117 of 142) | 98.0 % (48 of 49) | 65.7 % (46 of 70) | 100.0 % (23 of 23) |
Sidechain | 85.1 % (137 of 161) | 83.7 % (82 of 98) | 87.1 % (54 of 62) | 100.0 % (1 of 1) |
Aromatic | 83.3 % (20 of 24) | 83.3 % (10 of 12) | 81.8 % (9 of 11) | 100.0 % (1 of 1) |
Methyl | 100.0 % (22 of 22) | 100.0 % (11 of 11) | 100.0 % (11 of 11) |
1. eif3G Zn
KIVSCRICKG DHWTTRCPYK DTLGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.2) K, pH 6.3 (±1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | eif3G_Zn | natural abundance | 10 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | zinc chloride | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.2) K, pH 6.3 (±1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | eif3G_Zn | natural abundance | 10 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | zinc chloride | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.2) K, pH 6.3 (±1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | eif3G_Zn | natural abundance | 10 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | zinc chloride | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.2) K, pH 6.3 (±1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | eif3G_Zn | natural abundance | 10 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | zinc chloride | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.2) K, pH 6.3 (±1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | eif3G_Zn | natural abundance | 10 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | zinc chloride | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.2) K, pH 6.3 (±1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | eif3G_Zn | natural abundance | 10 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | zinc chloride | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.2) K, pH 6.3 (±1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | eif3G_Zn | natural abundance | 10 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | zinc chloride | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.2) K, pH 6.3 (±1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | eif3G_Zn | natural abundance | 10 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | zinc chloride | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.2) K, pH 6.3 (±1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | eif3G_Zn | natural abundance | 10 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | zinc chloride | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19716_2mjc.nef |
Input source #2: Coordindates | 2mjc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:15:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:19:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:24:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:12:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
Sequence alignments
-------10--------20--------30----- PLGSKGQKIVSCRICKGDHWTTRCPYKDTLGPMQ |||||||||||||||||||||||||||||||||| PLGSKGQKIVSCRICKGDHWTTRCPYKDTLGPMQ --------10--------20--------30----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 34 | 0 | 0 | 100.0 |
Content subtype: combined_19716_2mjc.nef
Assigned chemical shifts
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 211 | 119 | 56.4 |
13C chemical shifts | 152 | 72 | 47.4 |
15N chemical shifts | 36 | 22 | 61.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 44 | 63.8 |
13C chemical shifts | 68 | 22 | 32.4 |
15N chemical shifts | 31 | 21 | 67.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 142 | 75 | 52.8 |
13C chemical shifts | 84 | 50 | 59.5 |
15N chemical shifts | 5 | 1 | 20.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 10 | 71.4 |
13C chemical shifts | 14 | 10 | 71.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 12 | 10 | 83.3 |
13C chemical shifts | 11 | 9 | 81.8 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
Dihedral angle restraints
-------10--------20--------30----- PLGSKGQKIVSCRICKGDHWTTRCPYKDTLGPMQ |||||||| ||| |||||||| ........IVSCRICK.DHW.TRCPYKDT -------10--------20--------30