1H, 15N and 13C resonance assignments of the two TPR domains of the human RPAP3 protein
GPHMALVLKE KGNKYFKQGK YDEAIDCYTK GMDADPYNPV LPTNRASAYF RLKKFAVAES DCNLAVALNR SYTKAYSRRG AARFALQKLE EAKKDYERVL ELEPNNFEAT NELRKISQAL ASKENSY
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.9 % (1431 of 1508) | 95.5 % (757 of 793) | 92.9 % (540 of 581) | 100.0 % (134 of 134) |
Backbone | 99.1 % (745 of 752) | 98.4 % (250 of 254) | 99.2 % (373 of 376) | 100.0 % (122 of 122) |
Sidechain | 92.0 % (808 of 878) | 94.1 % (507 of 539) | 88.4 % (289 of 327) | 100.0 % (12 of 12) |
Aromatic | 57.1 % (72 of 126) | 71.4 % (45 of 63) | 42.9 % (27 of 63) | |
Methyl | 100.0 % (118 of 118) | 100.0 % (59 of 59) | 100.0 % (59 of 59) |
1. rpap3(133-255)
GPHMALVLKE KGNKYFKQGK YDEAIDCYTK GMDADPYNPV LPTNRASAYF RLKKFAVAES DCNLAVALNR SYTKAYSRRG AARFALQKLE EAKKDYERVL ELEPNNFEAT NELRKISQAL ASKENSYSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rpap3(133-255) | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | sodium chloride | natural abundance | 150 mM | |
3 | DTT | [U-99% 2H] | 10 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | [U-100% 2H] | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19758_6fd7.nef |
Input source #2: Coordindates | 6fd7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-130-----140-------150-------160-------170-------180-------190-------200-------210-------220-------2 GPHMALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPHMALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 30-------240-------250----- ELEPNNFEATNELRKISQALASKENSY ||||||||||||||||||||||||||| ELEPNNFEATNELRKISQALASKENSY -------110-------120-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 127 | 0 | 0 | 100.0 |
Content subtype: combined_19758_6fd7.nef
Assigned chemical shifts
-130-----140-------150-------160-------170-------180-------190-------200-------210-------220-------2 GPHMALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PHMALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVL 30-------240-------250----- ELEPNNFEATNELRKISQALASKENSY ||||||||||||||||||||||||||| ELEPNNFEATNELRKISQALASKENSY
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 793 | 758 | 95.6 |
13C chemical shifts | 581 | 537 | 92.4 |
15N chemical shifts | 142 | 132 | 93.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 254 | 250 | 98.4 |
13C chemical shifts | 254 | 250 | 98.4 |
15N chemical shifts | 122 | 120 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 539 | 508 | 94.2 |
13C chemical shifts | 327 | 287 | 87.8 |
15N chemical shifts | 20 | 12 | 60.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 61 | 100.0 |
13C chemical shifts | 61 | 61 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 45 | 71.4 |
13C chemical shifts | 63 | 25 | 39.7 |
Distance restraints
-130-----140-------150-------160-------170-------180-------190-------200-------210-------220-------2 GPHMALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PHMALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVL 30-------240-------250----- ELEPNNFEATNELRKISQALASKENSY ||||||||||||||||||||||||||| ELEPNNFEATNELRKISQALASKENSY
Dihedral angle restraints
-130-----140-------150-------160-------170-------180-------190-------200-------210-------220-------2 GPHMALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVL |||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PHMALVLKEKGNKYFKQGKYDEAIDCYTKGMDAD...PVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVL -130-----140-------150-------160-------170-------180-------190-------200-------210-------220-------2 30-------240-------250----- ELEPNNFEATNELRKISQALASKENSY || ||||||||||||||||||||| EL.PNNFEATNELRKISQALASKE 30-------240-------250--