NMR structure of the RRM domain of RBMX from homo sapiens
GHMVEADRPG KLFIGGLNTE TNEKALEAVF GKYGRIVEVL LMKDRETNKS RGFAFVTFES PADAKDAARD MNGKSLDGKA IKVEQATKPS FE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.7 % (967 of 1054) | 90.4 % (498 of 551) | 91.9 % (376 of 409) | 98.9 % (93 of 94) |
Backbone | 98.4 % (537 of 546) | 97.9 % (186 of 190) | 98.5 % (263 of 267) | 98.9 % (88 of 89) |
Sidechain | 86.6 % (512 of 591) | 86.4 % (312 of 361) | 86.7 % (195 of 225) | 100.0 % (5 of 5) |
Aromatic | 73.6 % (53 of 72) | 83.3 % (30 of 36) | 63.9 % (23 of 36) | |
Methyl | 100.0 % (90 of 90) | 100.0 % (45 of 45) | 100.0 % (45 of 45) |
1. entity
GHMVEADRPG KLFIGGLNTE TNEKALEAVF GKYGRIVEVL LMKDRETNKS RGFAFVTFES PADAKDAARD MNGKSLDGKA IKVEQATKPS FESolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium acetate | [U-99% 2H] | 10 mM | |
4 | sodium azide | natural abundance | 5 mM | |
5 | DTT | natural abundance | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19792_2mks.nef |
Input source #2: Coordindates | 2mks.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- GHMVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 92 | 0 | 0 | 100.0 |
Content subtype: combined_19792_2mks.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- GHMVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .HMVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 551 | 491 | 89.1 |
13C chemical shifts | 409 | 366 | 89.5 |
15N chemical shifts | 99 | 92 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 190 | 186 | 97.9 |
13C chemical shifts | 184 | 176 | 95.7 |
15N chemical shifts | 89 | 87 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 361 | 305 | 84.5 |
13C chemical shifts | 225 | 190 | 84.4 |
15N chemical shifts | 10 | 5 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 45 | 93.8 |
13C chemical shifts | 48 | 46 | 95.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 30 | 83.3 |
13C chemical shifts | 36 | 21 | 58.3 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-- GHMVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....EADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQAT --------10--------20--------30--------40--------50--------60--------70--------80-------