NMR structure of the C-domain of troponin C bound to the anchoring region of troponin I
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 73.6 % (616 of 837) | 75.6 % (331 of 438) | 66.6 % (215 of 323) | 92.1 % (70 of 76) |
Backbone | 80.8 % (349 of 432) | 94.0 % (141 of 150) | 65.7 % (138 of 210) | 97.2 % (70 of 72) |
Sidechain | 70.3 % (331 of 471) | 66.0 % (190 of 288) | 78.8 % (141 of 179) | 0.0 % (0 of 4) |
Aromatic | 21.4 % (12 of 56) | 42.9 % (12 of 28) | 0.0 % (0 of 28) | |
Methyl | 93.5 % (58 of 62) | 93.5 % (29 of 31) | 93.5 % (29 of 31) |
1. cCTnC
MGKSEEELSD LFRMFDKNAD GYIDLDELKI MLQATGETIT EDDIEELMKD GDKNNDGRID YDEFLEFMKG VESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
11 | Calcium | natural abundance | 2 mM | |
12 | DSS | natural abundance | 0.2 mM | |
13 | potassium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 5 mM | |
15 | imidazole | natural abundance | 0.5 mM | |
16 | troponin I(34-71) | natural abundance | 1.2 mM | |
17 | imidazole | [U-2H] | 9.5 mM | |
18 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
11 | Calcium | natural abundance | 2 mM | |
12 | DSS | natural abundance | 0.2 mM | |
13 | potassium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 5 mM | |
15 | imidazole | natural abundance | 0.5 mM | |
16 | troponin I(34-71) | natural abundance | 1.2 mM | |
17 | imidazole | [U-2H] | 9.5 mM | |
18 | D2O | natural abundance | 100 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
11 | Calcium | natural abundance | 2 mM | |
12 | DSS | natural abundance | 0.2 mM | |
13 | potassium chloride | natural abundance | 100 mM | |
14 | sodium azide | natural abundance | 5 mM | |
15 | imidazole | natural abundance | 0.5 mM | |
16 | troponin I(34-71) | natural abundance | 1.2 mM | |
17 | imidazole | [U-2H] | 9.5 mM | |
18 | D2O | natural abundance | 100 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | cCTnC | [U-95% 13C; U-95% 15N] | 0.5 mM | |
2 | Calcium | natural abundance | 2 mM | |
3 | DSS | natural abundance | 0.2 mM | |
4 | potassium chloride | natural abundance | 100 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | imidazole | natural abundance | 10 mM | |
7 | troponin I(34-71) | natural abundance | 1.2 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19816_2mle.nef |
Input source #2: Coordindates | 2mle.cif |
Diamagnetism of the molecular assembly | False (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:56:ASP:OD2 | 2:1:CA:CA | unknown | unknown | n/a |
1:63:GLU:OE1 | 2:1:CA:CA | unknown | unknown | n/a |
1:27:GLU:OE2 | 2:2:CA:CA | unknown | unknown | n/a |
1:20:ASP:OD1 | 2:2:CA:CA | unknown | unknown | n/a |
1:20:ASP:OD2 | 2:2:CA:CA | unknown | unknown | n/a |
1:27:GLU:OE1 | 2:2:CA:CA | unknown | unknown | n/a |
1:63:GLU:OE2 | 2:1:CA:CA | unknown | unknown | n/a |
1:56:ASP:OD1 | 2:1:CA:CA | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
A | 1 | CA | CALCIUM ION | None |
A | 2 | CA | CALCIUM ION | None |
Sequence alignments
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
C | C | 72 | 0 | 0 | 100.0 |
Content subtype: combined_19816_2mle.nef
Assigned chemical shifts
90------100-------110-------120-------130-------140-------150-------160- MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 438 | 331 | 75.6 |
13C chemical shifts | 323 | 216 | 66.9 |
15N chemical shifts | 78 | 70 | 89.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 150 | 143 | 95.3 |
13C chemical shifts | 144 | 71 | 49.3 |
15N chemical shifts | 72 | 70 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 288 | 188 | 65.3 |
13C chemical shifts | 179 | 145 | 81.0 |
15N chemical shifts | 6 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 36 | 100.0 |
13C chemical shifts | 36 | 36 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 10 | 35.7 |
13C chemical shifts | 28 | 0 | 0.0 |
Covalent bonds
Distance restraints
90------100-------110-------120-------130-------140-------150-------160- MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| M.KSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Dihedral angle restraints
90------100-------110-------120-------130-------140-------150-------160- MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE |||||||||||| ||||||||||||||| |||||||||| |||||||||||| ...SEEELSDLFRMF.....GYIDLDELKIMLQAT......DDIEELMKDG.....GRIDYDEFLEFM 90------100-------110-------120-------130-------140-------150-------