Solution NMR Structure of De novo designed protein, Northeast Structural Genomics Consortium (NESG) Target OR459
MAGKELRVEI KIDCGNDDKE TTYDLYFSKA EEAKELLKKV AEKAADKIKK QGCKRVKIRF EKKGLDDDAR KKAKKWALEV ANKIANELGA KQSTTTTDGD TFEVEVILEL EHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.4 % (1274 of 1394) | 91.1 % (668 of 733) | 92.6 % (498 of 538) | 87.8 % (108 of 123) |
Backbone | 90.7 % (637 of 702) | 89.2 % (214 of 240) | 93.0 % (321 of 345) | 87.2 % (102 of 117) |
Sidechain | 92.5 % (743 of 803) | 92.1 % (454 of 493) | 93.1 % (283 of 304) | 100.0 % (6 of 6) |
Aromatic | 65.9 % (54 of 82) | 65.9 % (27 of 41) | 65.0 % (26 of 40) | 100.0 % (1 of 1) |
Methyl | 99.2 % (121 of 122) | 98.4 % (60 of 61) | 100.0 % (61 of 61) |
1. OR459
MAGKELRVEI KIDCGNDDKE TTYDLYFSKA EEAKELLKKV AEKAADKIKK QGCKRVKIRF EKKGLDDDAR KKAKKWALEV ANKIANELGA KQSTTTTDGD TFEVEVILEL EHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H2O | natural abundance | 90 (±0.005) % | |
2 | D2O | natural abundance | 10 % | |
3 | OR459.005 | [U-13C,15N] | 1.17 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 1.17 mM OR459.005, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | OR459.005 | [5% 13C; U-15N] | 1.17 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25067_2mra.nef |
Input source #2: Coordindates | 2mra.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAGKELRVEIKIDCGNDDKETTYDLYFSKAEEAKELLKKVAEKAADKIKKQGCKRVKIRFEKKGLDDDARKKAKKWALEVANKIANELGAKQSTTTTDGD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAGKELRVEIKIDCGNDDKETTYDLYFSKAEEAKELLKKVAEKAADKIKKQGCKRVKIRFEKKGLDDDARKKAKKWALEVANKIANELGAKQSTTTTDGD -------110------- TFEVEVILELEHHHHHH ||||||||||||||||| TFEVEVILELEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 117 | 0 | 0 | 100.0 |
Content subtype: combined_25067_2mra.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAGKELRVEIKIDCGNDDKETTYDLYFSKAEEAKELLKKVAEKAADKIKKQGCKRVKIRFEKKGLDDDARKKAKKWALEVANKIANELGAKQSTTTTDGD | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .A.KELRVEIKIDCGNDDKETTYDLYFSKAEEAKELLKKVAEKAADKIKKQGCKRVKIRFEKKGLDDDARKKAKKWALEVANKIANELGAKQSTTTTDGD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------- TFEVEVILELEHHHHHH ||||||||||| TFEVEVILELE -------110-
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 733 | 660 | 90.0 |
13C chemical shifts | 538 | 486 | 90.3 |
15N chemical shifts | 127 | 104 | 81.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 240 | 213 | 88.7 |
13C chemical shifts | 234 | 211 | 90.2 |
15N chemical shifts | 117 | 98 | 83.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 493 | 447 | 90.7 |
13C chemical shifts | 304 | 275 | 90.5 |
15N chemical shifts | 10 | 6 | 60.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 61 | 98.4 |
13C chemical shifts | 62 | 61 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 25 | 61.0 |
13C chemical shifts | 40 | 24 | 60.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAGKELRVEIKIDCGNDDKETTYDLYFSKAEEAKELLKKVAEKAADKIKKQGCKRVKIRFEKKGLDDDARKKAKKWALEVANKIANELGAKQSTTTTDGD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| | ...KELRVEIKIDCGNDDKETTYDLYFSKAEEAKELLKKVAEKAADKIKKQGCKRVKIRFEKK.LDDDARKKAKKWALEVANKIANELGAKQSTTTTD.D --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------- TFEVEVILELEHHHHHH ||||||||||| TFEVEVILELE -------110-
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAGKELRVEIKIDCGNDDKETTYDLYFSKAEEAKELLKKVAEKAADKIKKQGCKRVKIRFEKKGLDDDARKKAKKWALEVANKIANELGAKQSTTTTDGD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| | ...KELRVEIKIDCGNDDKETTYDLYFSKAEEAKELLKKVAEKAADKIKKQGCKRVKIRFEKK.LDDDARKKAKKWALEVANKIANELGAKQSTTTTD.D --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------- TFEVEVILELEHHHHHH ||||||||||| TFEVEVILELE -------110-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAGKELRVEIKIDCGNDDKETTYDLYFSKAEEAKELLKKVAEKAADKIKKQGCKRVKIRFEKKGLDDDARKKAKKWALEVANKIANELGAKQSTTTTDGD |||||||||| ||||||| |||||||||||||||||||||| ||||||||| ||||||||||||||||||||| ||||||| ....ELRVEIKIDC....KETTYDL....AEEAKELLKKVAEKAADKIKKQ..KRVKIRFEK....DDARKKAKKWALEVANKIANE....QSTTTTD.. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------- TFEVEVILELEHHHHHH |||||||||| TFEVEVILEL -------110
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAGKELRVEIKIDCGNDDKETTYDLYFSKAEEAKELLKKVAEKAADKIKKQGCKRVKIRFEKKGLDDDARKKAKKWALEVANKIANELGAKQSTTTTDGD |||||||||| ||||||| |||||||||||||||||||||| ||||||||| ||||||||||||||||||||| ||||||| ....ELRVEIKIDC....KETTYDL....AEEAKELLKKVAEKAADKIKKQ..KRVKIRFEK....DDARKKAKKWALEVANKIANE....QSTTTTD.. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------- TFEVEVILELEHHHHHH |||||||||| TFEVEVILEL -------110