Solution Structure and Chemical Shift Assignments for BeF3 activated Receiver Domain of Nitrogen Regulatory Protein C ( NtrC ) at 35C
MQRGIVWVVD DDSSIRWVLE RALAGAGLTC TTFENGNEVL AALASKTPDV LLSDIRMPGM DGLALLKQIK QRHPMLPVII MTAHSDLDAA VSAYQQGAFD YLPKPFDIDE AVALVERAIS HYQE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.1 % (1380 of 1407) | 98.1 % (708 of 722) | 98.0 % (546 of 557) | 98.4 % (126 of 128) |
Backbone | 97.8 % (716 of 732) | 98.4 % (245 of 249) | 97.3 % (355 of 365) | 98.3 % (116 of 118) |
Sidechain | 98.5 % (780 of 792) | 97.9 % (463 of 473) | 99.4 % (307 of 309) | 100.0 % (10 of 10) |
Aromatic | 100.0 % (90 of 90) | 100.0 % (45 of 45) | 100.0 % (43 of 43) | 100.0 % (2 of 2) |
Methyl | 100.0 % (168 of 168) | 100.0 % (84 of 84) | 100.0 % (84 of 84) |
1. Receiver Domain of NtrC
MQRGIVWVVD DDSSIRWVLE RALAGAGLTC TTFENGNEVL AALASKTPDV LLSDIRMPGM DGLALLKQIK QRHPMLPVII MTAHSDLDAA VSAYQQGAFD YLPKPFDIDE AVALVERAIS HYQESolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.75
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Receiver Domain of NtrC | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | beryllium chloride | natural abundance | 4.4 mM | |
4 | sodium fluoride | natural abundance | 29 mM | |
5 | magnesium chloride | natural abundance | 7.2 mM | |
6 | H20 | natural abundance | 93 % | |
7 | D20 | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25124_2msk.nef |
Input source #2: Coordindates | 2msk.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFD -------110-------120---- YLPKPFDIDEAVALVERAISHYQE |||||||||||||||||||||||| YLPKPFDIDEAVALVERAISHYQE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 124 | 0 | 0 | 100.0 |
Content subtype: combined_25124_2msk.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFD -------110-------120---- YLPKPFDIDEAVALVERAISHYQE |||||||||||||||||||||||| YLPKPFDIDEAVALVERAISHYQE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
30 | CYS | HG | 1.351 |
35 | ASN | CG | 175.856 |
53 | SER | HG | 4.373 |
68 | GLN | CD | 179.69 |
71 | GLN | CD | 179.954 |
96 | GLN | CD | 178.87 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 722 | 710 | 98.3 |
13C chemical shifts | 557 | 545 | 97.8 |
15N chemical shifts | 134 | 126 | 94.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 249 | 247 | 99.2 |
13C chemical shifts | 248 | 238 | 96.0 |
15N chemical shifts | 118 | 116 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 473 | 463 | 97.9 |
13C chemical shifts | 309 | 307 | 99.4 |
15N chemical shifts | 16 | 10 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 89 | 100.0 |
13C chemical shifts | 89 | 89 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 45 | 45 | 100.0 |
13C chemical shifts | 43 | 43 | 100.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .QRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFD -------110-------120---- YLPKPFDIDEAVALVERAISHYQE |||||||||||||||||||||||| YLPKPFDIDEAVALVERAISHYQE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFD |||||||||||||||||||||||||||||| |||||||||||| ||| ||||||||||| ||||||||||||||||||||||||||| ...GIVWVVDDDSSIRWVLERALAGAGLTCTTF..GNEVLAALASKT..VLL.........GLALLKQIKQR.PMLPVIIMTAHSDLDAAVSAYQQGAFD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120---- YLPKPFDIDEAVALVERAISHYQE ||| ||||||||||||||||| YLP.PFDIDEAVALVERAISH -------110-------120-