NMR study of non-structural proteins - 1H, 13C, 15N resonance assigment of macro domain of Venezuelan equine encephalitis virus (VEEV)
APSYHVVRGD IATATEGVII NAANSKGQPG GGVCGALYKK FPESFDLQPI EVGKARLVKG AAKHIIHAVG PNFNKVSEVE GDKQLAEAYE SIAKIVNDNN YKSVAIPLLS TGIFSGNKDR LTQSLNHLLT ALDTTDADVA IYCRDKKWEM TLKEAVARRE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.9 % (1588 of 1806) | 87.1 % (813 of 933) | 89.5 % (631 of 705) | 85.7 % (144 of 168) |
Backbone | 94.9 % (900 of 948) | 93.3 % (305 of 327) | 96.8 % (452 of 467) | 92.9 % (143 of 154) |
Sidechain | 82.8 % (832 of 1005) | 83.8 % (508 of 606) | 83.9 % (323 of 385) | 7.1 % (1 of 14) |
Aromatic | 5.6 % (6 of 108) | 7.4 % (4 of 54) | 3.8 % (2 of 53) | 0.0 % (0 of 1) |
Methyl | 97.5 % (193 of 198) | 98.0 % (97 of 99) | 97.0 % (96 of 99) |
1. VEEV macro domain
APSYHVVRGD IATATEGVII NAANSKGQPG GGVCGALYKK FPESFDLQPI EVGKARLVKG AAKHIIHAVG PNFNKVSEVE GDKQLAEAYE SIAKIVNDNN YKSVAIPLLS TGIFSGNKDR LTQSLNHLLT ALDTTDADVA IYCRDKKWEM TLKEAVARRESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VEEV macro domain | [U-99% 15N] | 0.4 mM | |
2 | NaCl | natural abundance | 20 mM | |
3 | HEPES | natural abundance | 10 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details specific labeling with [U-15N]LEU-VAL-ALA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VEEV macro domain | [U-99% 15N] | 0.01 mM | |
8 | NaCl | natural abundance | 20 mM | |
9 | HEPES | natural abundance | 10 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details reverse labeling [U-14N]LYS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VEEV macro domain | [U-99% 15N] | 0.02 mM | |
11 | NaCl | natural abundance | 20 mM | |
12 | HEPES | natural abundance | 10 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | VEEV macro domain | natural abundance | 0.3 mM | |
14 | NaCl | natural abundance | 20 mM | |
15 | HEPES | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VEEV macro domain | [U-99% 15N] | 0.4 mM | |
2 | NaCl | natural abundance | 20 mM | |
3 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details specific labeling with [U-15N]LEU-VAL-ALA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | VEEV macro domain | [U-99% 15N] | 0.01 mM | |
8 | NaCl | natural abundance | 20 mM | |
9 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details reverse labeling [U-14N]LYS
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | VEEV macro domain | [U-99% 15N] | 0.02 mM | |
11 | NaCl | natural abundance | 20 mM | |
12 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | VEEV macro domain | natural abundance | 0.3 mM | |
14 | NaCl | natural abundance | 20 mM | |
15 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VEEV macro domain | [U-99% 15N] | 0.4 mM | |
2 | NaCl | natural abundance | 20 mM | |
3 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VEEV macro domain | [U-99% 15N] | 0.4 mM | |
2 | NaCl | natural abundance | 20 mM | |
3 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker Avance HD-III HD - 700 MHz equipped with TCI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.8 mM | |
5 | NaCl | natural abundance | 20 mM | |
6 | HEPES | natural abundance | 10 mM |
Bruker DPX - 400 MHz equipped with BBI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VEEV macro domain | [U-99% 15N] | 0.4 mM | |
2 | NaCl | natural abundance | 20 mM | |
3 | HEPES | natural abundance | 10 mM |
Bruker DPX - 400 MHz equipped with BBI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | VEEV macro domain | natural abundance | 0.3 mM | |
14 | NaCl | natural abundance | 20 mM | |
15 | HEPES | natural abundance | 10 mM |
Bruker DPX - 400 MHz equipped with BBI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | VEEV macro domain | natural abundance | 0.3 mM | |
14 | NaCl | natural abundance | 20 mM | |
15 | HEPES | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25132_5isn.nef |
Input source #2: Coordindates | 5isn.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 MKAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVND |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVND --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 00-------110-------120-------130-------140-------150-------160------ NNYKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARREHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NNYKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARREHHHHHH -------110-------120-------130-------140-------150-------160--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 168 | 0 | 0 | 100.0 |
Content subtype: combined_25132_5isn.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 MKAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVND |||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..APSYHVVRGDIATATEGVIINAANSKGQPG..VCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVND -0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 00-------110-------120-------130-------140-------150-------160------ NNYKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARREHHHHHH ||||||||||||| |||| ||||||||||||||||||||||||||||||||||||||||| NNYKSVAIPLLST.IFSG...RLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARRE 00-------110-------120-------130-------140-------150-------160
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
2 | PRO | N | 138.13 |
29 | PRO | N | 138.13 |
42 | PRO | N | 138.13 |
49 | PRO | N | 138.13 |
71 | PRO | N | 138.13 |
107 | PRO | N | 138.13 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 986 | 806 | 81.7 |
13C chemical shifts | 746 | 629 | 84.3 |
15N chemical shifts | 182 | 141 | 77.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 343 | 305 | 88.9 |
13C chemical shifts | 336 | 308 | 91.7 |
15N chemical shifts | 162 | 141 | 87.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 643 | 501 | 77.9 |
13C chemical shifts | 410 | 321 | 78.3 |
15N chemical shifts | 20 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 101 | 97 | 96.0 |
13C chemical shifts | 101 | 96 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 0 | 0.0 |
13C chemical shifts | 65 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 MKAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVND | |||||||||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..A.SYHVVRGDIATATEGVIINAANSKGQ.G..VCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVND -0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 00-------110-------120-------130-------140-------150-------160------ NNYKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARREHHHHHH ||||||||||||| |||| ||||||||||||||||||||||||||||||||||||||||| NNYKSVAIPLLST.IFSG...RLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARRE 00-------110-------120-------130-------140-------150-------160