The solution structure of the MANEC-type domain from Hepatocyte Growth Factor Inhibitor 1 reveals an unexpected PAN/apple domain-type fold
GADCLNSFTA GVPGFVLDTQ ASVSNGATFL ESPTVRRGWD CVRACCTTQN CNLALVELQP DRGEDAIAAC FLINCLYEQN FVCKFAPREG FINYLTREVY RSYRQLVDHH HHHH
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS4:SG | 1:CYS46:SG |
2 | disulfide | sing | 1:CYS41:SG | 1:CYS70:SG |
3 | disulfide | sing | 1:CYS45:SG | 1:CYS51:SG |
4 | disulfide | sing | 1:CYS75:SG | 1:CYS83:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 75.9 % (978 of 1288) | 72.6 % (479 of 660) | 78.4 % (396 of 505) | 83.7 % (103 of 123) |
Backbone | 90.5 % (612 of 676) | 86.1 % (199 of 231) | 93.1 % (312 of 335) | 91.8 % (101 of 110) |
Sidechain | 64.8 % (466 of 719) | 65.3 % (280 of 429) | 66.4 % (184 of 277) | 15.4 % (2 of 13) |
Aromatic | 21.7 % (30 of 138) | 37.7 % (26 of 69) | 4.4 % (3 of 68) | 100.0 % (1 of 1) |
Methyl | 81.1 % (99 of 122) | 77.0 % (47 of 61) | 85.2 % (52 of 61) |
1. entity 1
GADCLNSFTA GVPGFVLDTQ ASVSNGATFL ESPTVRRGWD CVRACCTTQN CNLALVELQP DRGEDAIAAC FLINCLYEQN FVCKFAPREG FINYLTREVY RSYRQLVDHH HHHHSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.6 % (2024 of 2576) | 79.3 % (1047 of 1320) | 75.8 % (766 of 1010) | 85.8 % (211 of 246) |
Backbone | 85.0 % (1149 of 1352) | 87.9 % (406 of 462) | 80.7 % (541 of 670) | 91.8 % (202 of 220) |
Sidechain | 74.5 % (1071 of 1438) | 74.7 % (641 of 858) | 76.0 % (421 of 554) | 34.6 % (9 of 26) |
Aromatic | 42.8 % (118 of 276) | 50.7 % (70 of 138) | 33.8 % (46 of 136) | 100.0 % (2 of 2) |
Methyl | 88.1 % (215 of 244) | 86.1 % (105 of 122) | 90.2 % (110 of 122) |
1. entity 1
GADCLNSFTA GVPGFVLDTQ ASVSNGATFL ESPTVRRGWD CVRACCTTQN CNLALVELQP DRGEDAIAAC FLINCLYEQN FVCKFAPREG FINYLTREVY RSYRQLVDHH HHHHSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Plus - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Plus - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Plus - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Plus - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Agilent DDR2 - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Plus - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % | |
4 | NaH2PO4 pH 6.5 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25139_2msx.nef |
Input source #2: Coordindates | 2msx.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:50:CYS:SG | A:92:CYS:SG | unknown | oxidized, CA 58.784, CB 42.145 ppm | 2.022 |
A:87:CYS:SG | A:116:CYS:SG | oxidized, CA 57.147, CB 37.485 ppm | oxidized, CA 53.949, CB 40.384 ppm | 2.024 |
A:91:CYS:SG | A:97:CYS:SG | oxidized, CA 57.695, CB 37.704 ppm | oxidized, CA 58.148, CB 43.234 ppm | 2.034 |
A:121:CYS:SG | A:129:CYS:SG | oxidized, CA 55.764, CB 41.707 ppm | oxidized, CA 56.15, CB 44.617 ppm | 2.031 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--50--------60--------70--------80--------90-------100-------110-------120-------130-------140------ GADCLNSFTAGVPGFVLDTQASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GADCLNSFTAGVPGFVLDTQASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -150-------160 RSYRQLVDHHHHHH |||||||||||||| RSYRQLVDHHHHHH -------110----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
Content subtype: combined_25139_2msx.nef
Assigned chemical shifts
--50--------60--------70--------80--------90-------100-------110-------120-------130-------140------ GADCLNSFTAGVPGFVLDTQASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVY || ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AD.LNSFTAG.PGFVLDTQASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVY --50--------60--------70--------80--------90-------100-------110-------120-------130-------140------ -150-------160 RSYRQLVDHHHHHH |||||||||| RSYRQLVDHH -150------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 505 | 381 | 75.4 |
1H chemical shifts | 660 | 451 | 68.3 |
15N chemical shifts | 131 | 100 | 76.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 228 | 206 | 90.4 |
1H chemical shifts | 231 | 190 | 82.3 |
15N chemical shifts | 110 | 99 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 277 | 175 | 63.2 |
1H chemical shifts | 429 | 261 | 60.8 |
15N chemical shifts | 21 | 1 | 4.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 61 | 50 | 82.0 |
1H chemical shifts | 61 | 47 | 77.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 68 | 0 | 0.0 |
1H chemical shifts | 69 | 23 | 33.3 |
15N chemical shifts | 1 | 1 | 100.0 |
--50--------60--------70--------80--------90-------100-------110-------120-------130-------140------ GADCLNSFTAGVPGFVLDTQASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVY || ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AD.LNSFTAG.PGFVLDTQASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVY --50--------60--------70--------80--------90-------100-------110-------120-------130-------140------ -150-------160 RSYRQLVDHHHHHH |||||||||| RSYRQLVDHH -150------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 660 | 554 | 83.9 |
13C chemical shifts | 505 | 332 | 65.7 |
15N chemical shifts | 131 | 105 | 80.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 231 | 202 | 87.4 |
13C chemical shifts | 228 | 99 | 43.4 |
15N chemical shifts | 110 | 99 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 429 | 352 | 82.1 |
13C chemical shifts | 277 | 233 | 84.1 |
15N chemical shifts | 21 | 6 | 28.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 58 | 95.1 |
13C chemical shifts | 61 | 58 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 41 | 59.4 |
13C chemical shifts | 68 | 40 | 58.8 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--50--------60--------70--------80--------90-------100-------110-------120-------130-------140------ GADCLNSFTAGVPGFVLDTQASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVY || | |||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AD..N.FTAG.PGFVLDTQASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVY --50--------60--------70--------80--------90-------100-------110-------120-------130-------140------ -150-------160 RSYRQLVDHHHHHH |||||||| RSYRQLVD -150----