The N-domain of the AAA metalloproteinase Yme1 from Saccharomyces cerevisiae
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.8 % (805 of 1009) | 81.3 % (425 of 523) | 81.4 % (320 of 393) | 64.5 % (60 of 93) |
Backbone | 77.9 % (405 of 520) | 79.3 % (138 of 174) | 80.2 % (210 of 262) | 67.9 % (57 of 84) |
Sidechain | 83.0 % (477 of 575) | 82.2 % (287 of 349) | 86.2 % (187 of 217) | 33.3 % (3 of 9) |
Aromatic | 61.9 % (52 of 84) | 61.9 % (26 of 42) | 61.9 % (26 of 42) | |
Methyl | 93.2 % (82 of 88) | 90.9 % (40 of 44) | 95.5 % (42 of 44) |
1. Yme1-N
MVAVSHAMLA TREQEANKDL TSPDAQAAFY KLLLQSNYPQ YVVSRFETPG IASSPECMEL YMEALQRIGR HSEADAVRQN LEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Yme1-N | [U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FtsH-N | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | TRIS | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FtsH-N | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | TRIS | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FtsH-N | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | TRIS | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FtsH-N | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | TRIS | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FtsH-N | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | TRIS | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FtsH-N | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | TRIS | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Yme1-N | [U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FtsH-N | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | TRIS | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Yme1-N | [U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Yme1-N | [U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FtsH-N | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | TRIS | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Yme1-N | [U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FtsH-N | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | TRIS | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | FtsH-N | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | TRIS | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25241_2mv3.nef |
Input source #2: Coordindates | 2mv3.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--100-------110-------120-------130-------140-------150-------160-------170-------180--- MVAVSHAMLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVAVSHAMLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNLEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 88 | 0 | 0 | 100.0 |
Content subtype: combined_25241_2mv3.nef
Assigned chemical shifts
--100-------110-------120-------130-------140-------150-------160-------170-------180--- MVAVSHAMLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..AVSHAMLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNL --100-------110-------120-------130-------140-------150-------160-------170------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
101 | HIS | HD1 | 6.92 |
101 | HIS | ND1 | 118.74 |
143 | THR | HG1 | 5.32 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 523 | 424 | 81.1 |
13C chemical shifts | 393 | 318 | 80.9 |
15N chemical shifts | 98 | 55 | 56.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 174 | 135 | 77.6 |
13C chemical shifts | 176 | 131 | 74.4 |
15N chemical shifts | 84 | 52 | 61.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 349 | 289 | 82.8 |
13C chemical shifts | 217 | 187 | 86.2 |
15N chemical shifts | 14 | 3 | 21.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 43 | 89.6 |
13C chemical shifts | 48 | 45 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 26 | 61.9 |
13C chemical shifts | 42 | 26 | 61.9 |
Distance restraints
--100-------110-------120-------130-------140-------150-------160-------170-------180--- MVAVSHAMLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNLEHHHHHH | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....H.MLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNL --100-------110-------120-------130-------140-------150-------160-------170------
--100-------110-------120-------130-------140-------150-------160-------170-------180--- MVAVSHAMLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNLEHHHHHH |||||||||||||| ||||||||||||||||||||||||||| || |||||||||||||||||||||||||| ......AMLATREQEANKDL.SPDAQAAFYKLLLQSNYPQYVVSRFET..IA.SPECMELYMEALQRIGRHSEADAVRQ --100-------110-------120-------130-------140-------150-------160-------170----
Dihedral angle restraints
--100-------110-------120-------130-------140-------150-------160-------170-------180--- MVAVSHAMLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVAVSHAMLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNLEHHHHHH