Resonance assignments of the periplasmic domain of a cellulose-sensing trans-membrane anti-sigma factor from Clostridium thermocellum
MYAYIDVDIN PSIGLVIDKK EKVIDAKPLN NDAKPILDEA APKDMPLYDA LSKILDISKK NGYINSADNI VLFSASINSG RNNVSESDKG IQEIISTLKD VAKDAGVKFE IIPSTEEDRQ KALDQNLSMG RYAIYVKAVE EGVNLNLEDA RNLSVSEILG KLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.7 % (1907 of 1951) | 97.5 % (990 of 1015) | 97.9 % (741 of 757) | 98.3 % (176 of 179) |
Backbone | 98.8 % (990 of 1002) | 98.5 % (335 of 340) | 99.2 % (495 of 499) | 98.2 % (160 of 163) |
Sidechain | 96.7 % (1073 of 1110) | 96.9 % (654 of 675) | 96.4 % (404 of 419) | 93.8 % (15 of 16) |
Aromatic | 76.1 % (70 of 92) | 76.1 % (35 of 46) | 76.1 % (35 of 46) | |
Methyl | 99.0 % (206 of 208) | 99.0 % (103 of 104) | 99.0 % (103 of 104) |
1. RsgI2-PD
MYAYIDVDIN PSIGLVIDKK EKVIDAKPLN NDAKPILDEA APKDMPLYDA LSKILDISKK NGYINSADNI VLFSASINSG RNNVSESDKG IQEIISTLKD VAKDAGVKFE IIPSTEEDRQ KALDQNLSMG RYAIYVKAVE EGVNLNLEDA RNLSVSEILG KLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI2-PD | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DSS | natural abundance | 0.02 % w/v |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr25358_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MYAYIDVDINPSIGLVIDKKEKVIDAKPLNNDAKPILDEAAPKDMPLYDALSKILDISKKNGYINSADNIVLFSASINSGRNNVSESDKGIQEIISTLKD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MYAYIDVDINPSIGLVIDKKEKVIDAKPLNNDAKPILDEAAPKDMPLYDALSKILDISKKNGYINSADNIVLFSASINSGRNNVSESDKGIQEIISTLKD -------110-------120-------130-------140-------150-------160--------- VAKDAGVKFEIIPSTEEDRQKALDQNLSMGRYAIYVKAVEEGVNLNLEDARNLSVSEILGKLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VAKDAGVKFEIIPSTEEDRQKALDQNLSMGRYAIYVKAVEEGVNLNLEDARNLSVSEILGKLEHHHHHH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1015 | 993 | 97.8 |
13C chemical shifts | 757 | 741 | 97.9 |
15N chemical shifts | 183 | 180 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 340 | 337 | 99.1 |
13C chemical shifts | 338 | 336 | 99.4 |
15N chemical shifts | 163 | 161 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 675 | 656 | 97.2 |
13C chemical shifts | 419 | 405 | 96.7 |
15N chemical shifts | 20 | 19 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 107 | 107 | 100.0 |
13C chemical shifts | 107 | 107 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 35 | 76.1 |
13C chemical shifts | 46 | 35 | 76.1 |