1H, 15N and 13C resonance assignments of translationally-controlled tumor protein from Nannochloropsis oceanica
MIVYKDVISG DEVVSDALKI TPVMEGGEEV PGLFEVDSAM VAVGGGDIDI GCGNAFGGAG DDEGADDATQ KENNVSGPSS FAYTAMPFSS KGEFKSWVKD YVRNVRQALK GSGVAVEDIK KFMEEAPTFV KWLVDKYDDL EFFMSKSMNP DAGLIFSYYK EGAHCPTFVY VKSGYKVVKF LEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.2 % (1813 of 2128) | 84.6 % (925 of 1093) | 85.1 % (719 of 845) | 88.9 % (169 of 190) |
Backbone | 90.3 % (1006 of 1114) | 88.7 % (345 of 389) | 92.1 % (501 of 544) | 88.4 % (160 of 181) |
Sidechain | 81.7 % (966 of 1182) | 82.4 % (580 of 704) | 80.4 % (377 of 469) | 100.0 % (9 of 9) |
Aromatic | 46.6 % (110 of 236) | 46.6 % (55 of 118) | 45.7 % (53 of 116) | 100.0 % (2 of 2) |
Methyl | 96.1 % (171 of 178) | 94.4 % (84 of 89) | 97.8 % (87 of 89) |
1. NoTCTP
MIVYKDVISG DEVVSDALKI TPVMEGGEEV PGLFEVDSAM VAVGGGDIDI GCGNAFGGAG DDEGADDATQ KENNVSGPSS FAYTAMPFSS KGEFKSWVKD YVRNVRQALK GSGVAVEDIK KFMEEAPTFV KWLVDKYDDL EFFMSKSMNP DAGLIFSYYK EGAHCPTFVY VKSGYKVVKF LEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NoTCTP | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 200 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | EDTA | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % w/v | |
7 | DSS | natural abundance | 0.01 % w/v |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr25391_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MIVYKDVISGDEVVSDALKITPVMEGGEEVPGLFEVDSAMVAVGGGDIDIGCGNAFGGAGDDEGADDATQKENNVSGPSSFAYTAMPFSSKGEFKSWVKD ||||||||||||||||||||||||| ||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||||||| ||||||||| MIVYKDVISGDEVVSDALKITPVME.GEEVPGLFEVDSAMVAVGGGDIDIG..NAF..AGDDEGADDATQKENNVSGPSSFAYTAMPFSS.GEFKSWVKD -------110-------120-------130-------140-------150-------160-------170-------180-------- YVRNVRQALKGSGVAVEDIKKFMEEAPTFVKWLVDKYDDLEFFMSKSMNPDAGLIFSYYKEGAHCPTFVYVKSGYKVVKFLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || YVRNVRQALKGSGVAVEDIKKFMEEAPTFVKWLVDKYDDLEFFMSKSMNPDAGLIFSYYKEGAHCPTFVYVKSGYKVVKF......HH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1093 | 929 | 85.0 |
13C chemical shifts | 845 | 709 | 83.9 |
15N chemical shifts | 192 | 165 | 85.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 389 | 347 | 89.2 |
13C chemical shifts | 376 | 343 | 91.2 |
15N chemical shifts | 181 | 156 | 86.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 704 | 582 | 82.7 |
13C chemical shifts | 469 | 366 | 78.0 |
15N chemical shifts | 11 | 9 | 81.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 87 | 90.6 |
13C chemical shifts | 96 | 87 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 118 | 42 | 35.6 |
13C chemical shifts | 116 | 40 | 34.5 |
15N chemical shifts | 2 | 2 | 100.0 |