Snu17p-Bud13p structure intermediate during RES complex assembly
GAMGNEYKDN AYIYIGNLNR ELTEGDILTV FSEYGVPVDV ILSRDENTGE SQGFAYLKYE DQRSTILAVD NLNGFKIGGR ALKIDHTFYR PKRSLQKYYE AVKEELDRDI VSKNNAEK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 82.6 % (1565 of 1895) | 87.6 % (872 of 995) | 74.8 % (544 of 727) | 86.1 % (149 of 173) |
Backbone | 81.6 % (770 of 944) | 92.6 % (302 of 326) | 71.1 % (330 of 464) | 89.6 % (138 of 154) |
Sidechain | 84.4 % (926 of 1097) | 85.2 % (570 of 669) | 84.4 % (345 of 409) | 57.9 % (11 of 19) |
Aromatic | 77.5 % (141 of 182) | 82.4 % (75 of 91) | 71.9 % (64 of 89) | 100.0 % (2 of 2) |
Methyl | 100.0 % (142 of 142) | 100.0 % (71 of 71) | 100.0 % (71 of 71) |
1. Snu17p
GAMGNEYKDN AYIYIGNLNR ELTEGDILTV FSEYGVPVDV ILSRDENTGE SQGFAYLKYE DQRSTILAVD NLNGFKIGGR ALKIDHTFYR PKRSLQKYYE AVKEELDRDI VSKNNAEK2. Bud13p
YDKPAPENRF AIMPGSRWDG VHRSNGFEEK WFAKQNEINE KSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | sodium phosphate | natural abundance | 25 mM | |
16 | sodium chloride | natural abundance | 250 mM | |
17 | sodium azide | natural abundance | 1 mM | |
18 | entity_1 | [U-13C; U-15N] | 1 mM | |
19 | entity_2 | [U-13C; U-15N] | 1 mM | |
20 | H2O | natural abundance | 90 % | |
21 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 25 mM | |
2 | sodium chloride | natural abundance | 250 mM | |
3 | sodium azide | natural abundance | 1 mM | |
4 | entity_1 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
5 | entity_2 | natural abundance | 1.0 ~ 1.2 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 250 mM | |
10 | sodium azide | natural abundance | 1 mM | |
11 | entity_1 | natural abundance | 1.0 ~ 1.2 mM | |
12 | entity_2 | [U-13C; U-15N] | 0.8 ~ 1.0 mM | |
13 | Snu17p | natural abundance | 90 % | |
14 | Snu17p | natural abundance | 10 % |
Bruker Avance - 900 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | sodium phosphate | natural abundance | 25 mM | |
16 | sodium chloride | natural abundance | 250 mM | |
17 | sodium azide | natural abundance | 1 mM | |
18 | entity_1 | [U-13C; U-15N] | 1 mM | |
19 | entity_2 | [U-13C; U-15N] | 1 mM | |
20 | H2O | natural abundance | 90 % | |
21 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz HCN cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.8, Details 160-180 uL, 3 mm tube
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | sodium phosphate | natural abundance | 25 mM | |
16 | sodium chloride | natural abundance | 250 mM | |
17 | sodium azide | natural abundance | 1 mM | |
18 | entity_1 | [U-13C; U-15N] | 1 mM | |
19 | entity_2 | [U-13C; U-15N] | 1 mM | |
20 | H2O | natural abundance | 90 % | |
21 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_25442_2my2.nef |
Input source #2: Coordindates | 2my2.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE -------110-------- AVKEELDRDIVSKNNAEK |||||||||||||||||| AVKEELDRDIVSKNNAEK
------310-------320-------330-------340-- YDKPAPENRFAIMPGSRWDGVHRSNGFEEKWFAKQNEINEK ||||||||||||||||||||||||||||||||||||||||| YDKPAPENRFAIMPGSRWDGVHRSNGFEEKWFAKQNEINEK --------10--------20--------30--------40-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 118 | 0 | 0 | 100.0 |
B | B | 41 | 0 | 0 | 100.0 |
Content subtype: combined_25442_2my2.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE ||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || |||| GAMGN.YKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRP..SL.KYYE -------110-------- AVKEELDRDIVSKNNAEK |||||||||||| ||||| AVKEELDRDIVS.NNAEK
------310-------320-------330-------340-- YDKPAPENRFAIMPGSRWDGVHRSNGFEEKWFAKQNEINEK ||||||||||||||||||||||||||||||||||||||||| YDKPAPENRFAIMPGSRWDGVHRSNGFEEKWFAKQNEINEK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 724 | 626 | 86.5 |
13C chemical shifts | 536 | 365 | 68.1 |
15N chemical shifts | 135 | 108 | 80.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 244 | 221 | 90.6 |
13C chemical shifts | 236 | 113 | 47.9 |
15N chemical shifts | 116 | 101 | 87.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 480 | 405 | 84.4 |
13C chemical shifts | 300 | 252 | 84.0 |
15N chemical shifts | 19 | 7 | 36.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 63 | 100.0 |
13C chemical shifts | 63 | 62 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 47 | 81.0 |
13C chemical shifts | 58 | 41 | 70.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 271 | 241 | 88.9 |
13C chemical shifts | 191 | 57 | 29.8 |
15N chemical shifts | 48 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 80 | 97.6 |
13C chemical shifts | 82 | 34 | 41.5 |
15N chemical shifts | 38 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 189 | 161 | 85.2 |
13C chemical shifts | 109 | 23 | 21.1 |
15N chemical shifts | 10 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 10 | 10 | 100.0 |
13C chemical shifts | 10 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 28 | 84.8 |
13C chemical shifts | 31 | 23 | 74.2 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYE | || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| ||| | ||| ..M...YK..AYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKI.GRALKIDHT.YRP...L..YYE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------- AVKEELDRDIVSKNNAEK |||||||| || AVKEELDR.IV -------110-
------310-------320-------330-------340-- YDKPAPENRFAIMPGSRWDGVHRSNGFEEKWFAKQNEINEK |||||||||||||||||||||||||||||||||||| | ..KPAPENRFAIMPGSRWDGVHRSNGFEEKWFAKQNEI.E ------310-------320-------330-------340-